DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Strn-Mlck and Palld

DIOPT Version :10

Sequence 1:NP_001261019.1 Gene:Strn-Mlck / 36753 FlyBaseID:FBgn0265045 Length:8255 Species:Drosophila melanogaster
Sequence 2:NP_001280701.1 Gene:Palld / 72333 MGIID:1919583 Length:1408 Species:Mus musculus


Alignment Length:1778 Identity:359/1778 - (20%)
Similarity:558/1778 - (31%) Gaps:596/1778 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly  5043 SAIDEKSQKAEVSETVSEKITDEKAQES--------QKKEVKDSEAKPKKAKILEKKSIEI---- 5095
            |.:.|:.:.|:....:|..::.|:..:|        ...|.:|.:::.:.::|..|..|.:    
Mouse    15 SDVQEEGKSADFFPGLSAFLSQEEINKSLDLARRAIDSSETEDFDSEKEISQIFSKSPISLCETP 79

  Fly  5096 EKLDEKKEKQTETKVATDTKSQTVEVSEIVLEKISEEKAEESQKVELKDSEAKSKKAKVLEKKST 5160
            ...:.|..|||.::...|::...|       :.::.::||   ::....|:.|...:.:|...|.
Mouse    80 SHEEPKSGKQTSSERPQDSRRAPV-------QPLTGDQAE---RITSPGSKRKPGVSPLLASPSY 134

  Fly  5161 LKEKLDENDKKQKEDGATNKSQKAEAADVVPEKISEEKVAEIKTPEPMDSKAKSKPDGLPADEKS 5225
            ::..     :|.::.||.|           |...|:.|.|:         ::|:.|.....|:.:
Mouse   135 IRSL-----RKAEKRGAKN-----------PNPSSKPKTAQ---------QSKAGPQSQLCDKAA 174

  Fly  5226 HGAKVSESVPVKNEAEKTDQLSAKKPTVLDEDLVVPKRKPYLAEQTADSISLQTYKSMDSEYKDR 5290
              :.:.|...:..||.|                  |:.:....|.:          |.||.|...
Mouse   175 --SFIEELTSIFREAAK------------------PRNRSPNGESS----------SPDSGYLSP 209

  Fly  5291 KE------SRSAKRKPTVDIQLTNRNTASGSDLKLTCGLSGHEMNVQWFKDNCPIENGAKYRRTL 5349
            |.      |.||.:.||.|                  .|...||:.                   
Mouse   210 KNQPSALMSASASQSPTAD------------------QLDQLEMDA------------------- 237

  Fly  5350 NDGLSCLEIKSAELGDSGIYRCIASNQNGEVETSCLVTIYEAPSSK---FGTPPIFTRNIRDAYH 5411
                   |:|.|: |.    .|..::|..| ||..|..|......|   ..|.|.|.:.:|....
Mouse   238 -------EVKQAQ-GS----LCYQAHQASE-ETLPLAHIPHPQPQKARHLPTAPRFIQKLRSQEV 289

  Fly  5412 SQGNQLTLECKVSGSPKPHIYWQRDNTLLPIEGTKYQYEEQSDGIKLLTINNFGSNDSGLYTCYA 5476
            ::|:::.|||:|:|:|.|.:.|..:...| ......|...:|..:..|.|.....:|:|.|||.|
Mouse   290 AEGSRVYLECRVTGNPTPRVRWFCEGKEL-YNSPDVQIHCESGELHTLVIAEAFEDDTGRYTCLA 353

  Fly  5477 ESENGQMKISKFVQASDYVRERIADKKPIDKVIQEIKRDESSSAAANDTAAAKAKAREAKLRLNL 5541
            .:.:|                  :|....:..|:.....:|.|.:.:..:.|.|..:..|     
Mouse   354 TNPSG------------------SDSTSAEVFIEGASSTDSDSESLSFISKAGAMPQAQK----- 395

  Fly  5542 ETSLKTMTIGSGNKAQLICYVTGIIEDVHWLRNDERVTKDARHKIYNINGAISLEIYDARVEDSG 5606
            :|:..::||||  .|......|.:|:                        .:|:.:..|....| 
Mouse   396 KTTSVSLTIGS--SAPKTGVTTAVIQ------------------------PLSVPVQQAHSATS- 433

  Fly  5607 HYRC-------------VVKNSRQTVESAGQLSVLDQSTGKLPESFSSGIIESYDDQRNEIVLSC 5658
             |.|             ..|..:.|..|.||:                            :||.|
Mouse   434 -YLCRPDGTTMGCLLPVFTKELQNTAASEGQV----------------------------VVLEC 469

  Fly  5659 QVIGRP--SVSWMRD--------DHSICNNRYRTIEEPGGVRKLVIRNPISSDCGIFACYAEHE- 5712
            :|.|.|  .|.|.|.        |..|...:.|:..||..:..|||......|.|||.|.|.:: 
Mouse   470 RVRGAPPLQVQWFRQGSEIQDSPDFRILQKKPRSTAEPEEICTLVIAESFPEDAGIFTCSATNDY 534

  Fly  5713 ---------------------------------------------------------DRIDSTSI 5720
                                                                     .:::|.::
Mouse   535 GSVTSTAQLVITSANNENCSYDSTGEPNSDHFQHFPPPPPILETGSYELASQKPSEIQQVNSPNL 599

  Fly  5721 TIKAADLKRLINVSQEEIPSIGDHESTPWSRSQSHLSSGSQVNG--NGELHRAGDRVLRNVGKGK 5783
            ....|.|:...|.::.|...:             |.|.|  |||  ||:.:          |...
Mouse   600 GFSMAALQMQFNTAERETNGV-------------HPSHG--VNGLINGKAY----------GNKS 639

  Fly  5784 PLFHTLLHDRTVSEGANLRLVCSVSGDENTHIEWLKNHKPL---PRSDNRYQTVYLNGEASLEIF 5845
            |...|.|...|                        |...||   |:.| ..:...|..:..||..
Mouse   640 PPTPTALLSPT------------------------KEPPPLLAKPKLD-PLKLQQLQNQVRLEQE 679

  Fly  5846 AAVADDSGNYTCCATNDFGESLTHAQLRVYKNFKEAPLPSTFTQPIRDTYSLNENELVLDCRVRG 5910
            |.....:.....|.::..|.|...:.       ...|.|..|.:             :..|   .
Mouse   680 ACAWPPAPPGVPCNSSSSGSSAPPSP-------PFPPPPPAFPE-------------LAAC---A 721

  Fly  5911 QPRPEIQWIKGTEPIEASEKFKPSDQADG---YAKLVIVNPTEKDSGIYWCVARNEGAENKISHQ 5972
            .|.|       :||:.|......:.|:.|   ||:     |.:      :..|:|.|..:.:...
Mouse   722 SPVP-------SEPMSALASRATAMQSSGSFNYAR-----PKQ------FIAAQNLGPASGLPTP 768

  Fly  5973 VDFKGRQHY--SLEKTHGFFHRDPNKPHFLLPLGNQTVCNGGTVAISAEFMETSTPIEVKWLRDR 6035
            .........  .|..|...|.|.|..|                      |:|.    |..|....
Mouse   769 TSSPSSSSLPSPLSPTPRPFGRAPGPP----------------------FVEP----EAMWGPSS 807

  Fly  6036 RVVDGPNVKALADRGVYTLTIMNAGPEV-----------EGTYTCRASNAFGRIESNVNVDVAVG 6089
            .....|.....:....|.:      |:|           ..|..|.:...||             
Mouse   808 PSPPPPPPPVFSPSAAYPV------PDVFPLPPPPPPLPSSTSHCASPARFG------------- 853

  Fly  6090 AEKDERPPLFLSR--PDTEMKIAV------------GDP--FSLSFRIAGDPKPKLTFMKGTKDI 6138
              ..:.|..|||.  |.....:||            |.|  .|.:.|||.|.:     ::||||.
Mouse   854 --PSQTPAAFLSALLPSQPPPVAVNALGLPKGVTPAGFPKKSSRTARIASDEE-----IQGTKDA 911

  Fly  6139 TQSDRVSKEVSDDYTRFSVQQAQISDSG----TYFV-VARNNFGTDRIFVTVTVNPRARSATPTQ 6198
            ...|...|      .||   :..:.::|    ||.. :||...|.|...|.....|...:|..  
Mouse   912 VIQDLERK------LRF---KEDLLNNGQPRLTYEERMARRLLGADSANVFNIQEPEETAANQ-- 965

  Fly  6199 PRWGLPLDSYSDTSYFRDPPGCISTEPLVVDSGPTHISLSWGKPVSANSAPVMAYKVEAWVVGHE 6263
                                          |:|....|:  |.|:....    .|||        
Mouse   966 ------------------------------DAGAPRASV--GGPLDGQK----EYKV-------- 986

  Fly  6264 GGAYWRELGLTPINSFDAFNLKPNVEYHFRVTPKNRYGWG------PTVQTSSPLQVGGVECLPE 6322
                          |.....|...:||....:|.:..|..      |....::|           
Mouse   987 --------------SSCEQRLISEIEYRLERSPVDESGDEVQDPDVPVENATAP----------- 1026

  Fly  6323 FVKILPGQAKALLGSSFTLQCNMRGAPRPQVTWFKDGIQLSSSSERVKI-RQIGSTCALTIATVS 6386
            |.::.....|...|...|..|.:.|.|:|::.|||||.|:|..|:...| |.:..||:|. .|.|
Mouse  1027 FFEMKLKHYKIFEGMPVTFTCRVAGNPKPKIYWFKDGKQISPKSDHYTIQRDLDGTCSLH-TTAS 1090

  Fly  6387 EL-DSGRYTCEATNSKGRVSTFARLQVVSDSRIYEADSRLKEIAHGR----NVADVGDS------ 6440
            .| |.|.||..|.|.:||||...||.|.:.::...:........|.|    ...|.||.      
Mouse  1091 TLDDDGNYTIMAANPQGRVSCTGRLMVQAVNQRGRSPRSPSGHPHARRPRSRSRDSGDENEPIQE 1155

  Fly  6441 ---LPIFTMRLRDRRVQVTYPVRLTCQIVGYPVPEILWYKDDELIHTDRKH-LISAEGQFFTLEI 6501
               .|.|.....|..||.....|:.|::.|.|.|::.|..|.:.|..|..| ::..|....:|.|
Mouse  1156 RFFRPHFLQAPGDLTVQEGKLCRMDCKVSGLPTPDLSWQLDGKPIRPDSAHKMLVRENGVHSLII 1220

  Fly  6502 AATTLDDSGTYTCLARNELGSVSCHCTLVVDKGIRAYISPDFYVPLDPFYIFREGSEIRLSTKVE 6566
            ...|..|:|.|||:|.|..|..|.:..||| ....|:.:|.|...|....: .:|..:||..:|.
Mouse  1221 EPVTSRDAGIYTCIATNRAGQNSFNLELVV-AAKEAHKAPVFMEKLQNTGV-ADGYPVRLECRVS 1283

  Fly  6567 AYPSVGVTWHRNGMRLRPS-RRLTATLDSNGYVELIIAEATVRDAGIYVCVASNVVGKVETICRV 6630
            ..|...:.|.:....|..| .|::...|::||:.|:|..||..|||.|...|.|..|.|....|:
Mouse  1284 GVPPPQIFWKKENESLTHSTERVSMHQDNHGYICLLIQGATKEDAGWYTVSAKNEAGIVSCTARL 1348

  Fly  6631 AV--------EEAENKAVAPQRS 6645
            .|        :..:.|.|.|..|
Mouse  1349 DVYTQWHQQPQTTKPKKVRPSAS 1371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Strn-MlckNP_001261019.1 Ig_3 26..112 CDD:464046
Ig <70..112 CDD:472250
Ig strand E 92..96 CDD:409353
Ig strand F 106..111 CDD:409353
Ig 137..226 CDD:472250
Ig strand B 154..158 CDD:409353
Ig strand C 167..171 CDD:409353
Ig strand E 192..196 CDD:409353
Ig strand F 206..211 CDD:409353
Ig strand G 219..222 CDD:409353
Ig 235..314 CDD:472250
Ig strand B 251..255 CDD:409564
Ig strand C 264..268 CDD:409564
Ig strand E 280..284 CDD:409564
Ig strand F 294..299 CDD:409564
Ig strand G 307..310 CDD:409564
Ig_3 336..414 CDD:464046
Ig 438..513 CDD:472250
Ig strand B 454..458 CDD:409564
Ig strand C 467..471 CDD:409564
Ig strand E 483..487 CDD:409564
Ig strand F 493..498 CDD:409564
Ig strand G 506..509 CDD:409564
Ig 537..628 CDD:472250
Ig strand B 554..558 CDD:409353
Ig strand C 567..571 CDD:409353
Ig strand F 607..612 CDD:409353
Ig strand G 620..623 CDD:409353
Ig 636..713 CDD:472250
Ig strand B 652..656 CDD:409564
Ig strand C 665..669 CDD:409564
Ig strand E 681..685 CDD:409564
Ig strand F 695..700 CDD:409564
Ig strand G 708..711 CDD:409564
SMC_N <2131..2664 CDD:481474
PTZ00121 <2600..3256 CDD:173412
PTZ00121 <3635..4609 CDD:173412
PTZ00121 <4215..5072 CDD:173412 6/36 (17%)
I-set 5300..5388 CDD:400151 16/87 (18%)
Ig strand B 5317..5321 CDD:409353 0/3 (0%)
Ig strand C 5329..5333 CDD:409353 0/3 (0%)
Ig strand E 5354..5358 CDD:409353 0/3 (0%)
Ig strand F 5368..5373 CDD:409353 1/4 (25%)
Ig_3 5399..5477 CDD:464046 22/77 (29%)
Ig 5542..5627 CDD:472250 18/97 (19%)
Ig strand B 5556..5560 CDD:409353 1/3 (33%)
Ig strand C 5568..5572 CDD:409353 0/3 (0%)
Ig strand E 5593..5597 CDD:409353 1/3 (33%)
Ig strand F 5607..5612 CDD:409353 2/17 (12%)
Ig 5654..5721 CDD:409353 24/134 (18%)
Ig strand B 5654..5658 CDD:409353 2/3 (67%)
Ig strand C 5665..5669 CDD:409353 1/3 (33%)
Ig strand E 5690..5694 CDD:409353 1/3 (33%)
Ig strand F 5704..5709 CDD:409353 3/4 (75%)
Ig strand G 5718..5721 CDD:409353 0/2 (0%)
I-set 5784..5874 CDD:400151 16/92 (17%)
Ig strand B 5801..5805 CDD:409353 0/3 (0%)
Ig strand C 5814..5818 CDD:409353 0/3 (0%)
Ig strand E 5840..5844 CDD:409353 1/3 (33%)
Ig strand F 5854..5859 CDD:409353 0/4 (0%)
Ig 5902..5963 CDD:409353 12/63 (19%)
Ig strand B 5902..5906 CDD:409353 0/3 (0%)
Ig strand C 5915..5919 CDD:409353 0/3 (0%)
Ig strand E 5941..5945 CDD:409353 1/3 (33%)
Ig strand F 5955..5960 CDD:409353 0/4 (0%)
Ig 5997..6086 CDD:472250 13/99 (13%)
Ig strand B 6014..6018 CDD:409353 0/3 (0%)
Ig strand C 6028..6032 CDD:409353 1/3 (33%)
Ig strand E 6050..6056 CDD:409353 1/5 (20%)
Ig strand F 6066..6071 CDD:409353 2/4 (50%)
Ig strand G 6079..6082 CDD:409353 0/2 (0%)
Ig 6107..6187 CDD:472250 25/98 (26%)
Ig strand B 6115..6119 CDD:409353 1/3 (33%)
Ig strand C 6128..6132 CDD:409353 0/3 (0%)
Ig strand E 6153..6157 CDD:409353 2/3 (67%)
Ig strand F 6167..6172 CDD:409353 2/5 (40%)
Ig strand G 6180..6183 CDD:409353 0/2 (0%)
FN3 6216..6310 CDD:238020 15/99 (15%)
I-set 6321..6412 CDD:400151 36/92 (39%)
Ig strand B 6339..6343 CDD:409353 1/3 (33%)
Ig strand C 6352..6356 CDD:409353 0/3 (0%)
Ig strand E 6375..6382 CDD:409353 3/6 (50%)
Ig strand F 6392..6397 CDD:409353 2/4 (50%)
Ig strand G 6405..6408 CDD:409353 1/2 (50%)
I-set 6442..6531 CDD:400151 29/89 (33%)
Ig strand B 6459..6463 CDD:409353 1/3 (33%)
Ig strand C 6472..6476 CDD:409353 0/3 (0%)
Ig strand E 6497..6501 CDD:409353 1/3 (33%)
Ig strand F 6511..6516 CDD:409353 3/4 (75%)
Ig strand G 6524..6527 CDD:409353 1/2 (50%)
Ig 6541..6632 CDD:472250 28/91 (31%)
Ig strand B 6559..6563 CDD:409353 2/3 (67%)
Ig strand C 6572..6576 CDD:409353 0/3 (0%)
Ig strand E 6598..6602 CDD:409353 1/3 (33%)
Ig strand F 6612..6617 CDD:409353 1/4 (25%)
Ig strand G 6625..6628 CDD:409353 0/2 (0%)
Ig 6662..6754 CDD:472250
Ig strand B 6679..6683 CDD:409353
Ig strand C 6692..6696 CDD:409353
Ig strand E 6720..6724 CDD:409353
Ig strand F 6734..6739 CDD:409353
I-set 6779..6868 CDD:400151
Ig strand B 6796..6800 CDD:409353
Ig strand C 6809..6813 CDD:409353
Ig strand E 6834..6838 CDD:409353
Ig strand F 6848..6853 CDD:409353
I-set 6939..7028 CDD:400151
Ig strand B 6956..6960 CDD:409353
Ig strand C 6969..6973 CDD:409353
Ig strand E 6993..6998 CDD:409353
Ig strand F 7008..7013 CDD:409353
Ig strand G 7021..7024 CDD:409353
IG_like 7075..7140 CDD:214653
Ig strand C 7082..7086 CDD:409353
Ig strand E 7107..7111 CDD:409353
Ig strand F 7121..7126 CDD:409353
Ig strand G 7135..7138 CDD:409353
Ig 7173..7232 CDD:409353
Ig strand C 7184..7188 CDD:409353
Ig strand E 7210..7214 CDD:409353
Ig strand F 7224..7229 CDD:409353
IG_like 7406..7475 CDD:214653
Ig strand B 7413..7417 CDD:409353
Ig strand C 7426..7430 CDD:409353
Ig strand E 7451..7455 CDD:409353
Ig strand F 7465..7470 CDD:409353
FN3 7489..7588 CDD:238020
STKc_MLCK 7626..7876 CDD:271005
PalldNP_001280701.1 IgI_2_Titin_Z1z2-like 277..368 CDD:409564 25/109 (23%)
Ig strand A 277..280 CDD:409564 1/2 (50%)
Ig strand A' 283..287 CDD:409564 1/3 (33%)
Ig strand B 295..303 CDD:409564 4/7 (57%)
Ig strand C 308..313 CDD:409564 1/4 (25%)
Ig strand C' 316..318 CDD:409564 0/1 (0%)
Ig strand D 324..329 CDD:409564 1/4 (25%)
Ig strand E 333..338 CDD:409564 1/4 (25%)
Ig strand F 347..355 CDD:409564 5/7 (71%)
Ig strand G 358..368 CDD:409564 2/27 (7%)
I-set 448..545 CDD:400151 28/124 (23%)
Ig strand B 465..469 CDD:409353 2/3 (67%)
Ig strand C 478..482 CDD:409353 1/3 (33%)
Ig strand E 511..515 CDD:409353 1/3 (33%)
Ig strand F 525..530 CDD:409353 3/4 (75%)
Ig strand G 538..541 CDD:409353 0/2 (0%)
IgI_1_Palladin_C 1026..1117 CDD:409474 37/102 (36%)
Ig strand A 1026..1029 CDD:409474 2/13 (15%)
Ig strand A' 1032..1037 CDD:409474 0/4 (0%)
Ig strand B 1042..1049 CDD:409474 2/6 (33%)
Ig strand C 1056..1062 CDD:409474 2/5 (40%)
Ig strand C' 1063..1066 CDD:409474 1/2 (50%)
Ig strand D 1073..1079 CDD:409474 2/5 (40%)
Ig strand E 1082..1092 CDD:409474 5/10 (50%)
Ig strand F 1096..1104 CDD:409474 4/7 (57%)
Ig strand G 1106..1117 CDD:409474 6/10 (60%)
Ig 1160..1250 CDD:472250 29/89 (33%)
Ig strand B 1177..1181 CDD:409353 1/3 (33%)
Ig strand C 1190..1194 CDD:409353 0/3 (0%)
Ig strand E 1216..1220 CDD:409353 1/3 (33%)
Ig strand F 1230..1235 CDD:409353 3/4 (75%)
Ig strand G 1243..1246 CDD:409353 1/2 (50%)
IgI_Myotilin_C 1259..1350 CDD:409473 28/91 (31%)
Ig strand A 1259..1262 CDD:409473 1/2 (50%)
Ig strand A' 1265..1270 CDD:409473 1/4 (25%)
Ig strand B 1275..1282 CDD:409473 2/6 (33%)
Ig strand C 1289..1295 CDD:409473 1/5 (20%)
Ig strand C' 1296..1299 CDD:409473 0/2 (0%)
Ig strand D 1306..1312 CDD:409473 0/5 (0%)
Ig strand E 1315..1325 CDD:409473 4/9 (44%)
Ig strand F 1329..1337 CDD:409473 3/7 (43%)
Ig strand G 1339..1350 CDD:409473 3/10 (30%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.