DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Strn-Mlck and MYLK

DIOPT Version :10

Sequence 1:NP_001261019.1 Gene:Strn-Mlck / 36753 FlyBaseID:FBgn0265045 Length:8255 Species:Drosophila melanogaster
Sequence 2:XP_024309300.1 Gene:MYLK / 4638 HGNCID:7590 Length:1924 Species:Homo sapiens


Alignment Length:2295 Identity:556/2295 - (24%)
Similarity:869/2295 - (37%) Gaps:628/2295 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly  5880 EAPLPSTFTQPIRDTYSLNENELVLDCRVRGQPRPEIQWIKGTEPIEASEKFKPSDQADGYAKLV 5944
            |||   .|..|.|:...........:.||||.|.|::.|.:..:||.:..:|.......|...||
Human    41 EAP---AFILPPRNLCIKEGATAKFEGRVRGYPEPQVTWHRNGQPITSGGRFLLDCGIRGTFSLV 102

  Fly  5945 IVNPTEKDSGIYWCVARNEGAENKISHQVDFKGRQHYSLEKTHGFFHRDPNKPHFLLPLGNQTVC 6009
            |....|:|.|.|.|.|.|.....:::.::..:|                    .|...||...|.
Human   103 IHAVHEEDRGKYTCEATNGSGARQVTVELTVEG--------------------SFAKQLGQPVVS 147

  Fly  6010 NGGTVAISAEFMETSTPIEVKWLRDRRVVDGPNVKALADRGVYTLTIMNAGPEVEGTYTCRASNA 6074
                                              |.|.||  ::...:...|.:.|         
Human   148 ----------------------------------KTLGDR--FSAPAVETRPSIWG--------- 167

  Fly  6075 FGRIESNVNVDVAVGAEKDERPPLFLSRPDTEMKIAVGDPFSLSFRIAGDPKPKLTFMKGTKDIT 6139
                               |.||.|.::.. .:.:..|.....|.:|.|.|:|::|::||...:.
Human   168 -------------------ECPPKFATKLG-RVVVKEGQMGRFSCKITGRPQPQVTWLKGNVPLQ 212

  Fly  6140 QSDRVSKEVSDDYTRFSVQQAQISDSGTYFVVARNNFG---------------TDRIFV--TVTV 6187
            .|.|||....:......:......|.|.|..:..|..|               .:|.||  |...
Human   213 PSARVSVSEKNGMQVLEIHGVNQDDVGVYTCLVVNGSGKASMSAELSIQGLDSANRSFVRETKAT 277

  Fly  6188 NPRARSATPTQPRWGLPLDSYSDTSYFRD---------PPGCISTEPLVVDSGPTHISLSWGK-- 6241
            |...|............|||....:..::         ||...:::|    ..|....|...|  
Human   278 NSDVRKEVTNVISKESKLDSLEAAAKSKNCSSPQRGGSPPWAANSQP----QPPRESKLESCKDS 338

  Fly  6242 PVSANSAPVM-----AYKVEAWVVGHEGGAYWRELGLTPINSFDAFNLKPNVEYHFRVTPKNRYG 6301
            |.:|...||:     :..::|..|..|..|  ..||:          |.|:.|...|..|. |..
Human   339 PRTAPQTPVLQKTSSSITLQAARVQPEPRA--PGLGV----------LSPSGEERKRPAPP-RPA 390

  Fly  6302 WGPTVQTS--------------SPLQVGGVECLPEFVKILPGQAKALLGSSFTLQCNMRGAPRPQ 6352
            ..||.|..              .|::.......|:| :..|...:.....:...:|.:.|.|:|:
Human   391 TFPTRQPGLGSQDVVSKAANRRIPMEGQRDSAFPKF-ESKPQSQEVKENQTVKFRCEVSGIPKPE 454

  Fly  6353 VTWFKDGIQLSSSSERVKIRQIGSTCALTIATVSELDSGRYTCEATNSKGRVSTFARLQVVSDSR 6417
            |.||.:|..:......:::.:...:..|.:......|||.|:|.|:|::|::|....|||   .|
Human   455 VAWFLEGTPVRRQEGSIEVYEDAGSHYLCLLKARTRDSGTYSCTASNAQGQLSCSWTLQV---ER 516

  Fly  6418 IYEADSRLKEIAHGRNVADVGDSLPIFTMRLRDRRVQVTYPVRLTCQIVGYPVPEILWYKDDELI 6482
            :     .:.|:|            |.|:..|:|..|.......|.|.:.|.|||.|.|..:.:.|
Human   517 L-----AVMEVA------------PSFSSVLKDCAVIEGQDFVLQCSVRGTPVPRITWLLNGQPI 564

  Fly  6483 HTDRKHLISAEGQFFTLEIAATTLDDSGTYTCLARNELGSVSCHCTLVVDKGIRAYISPDFYVPL 6547
            ...|.   :.|.....|.|.....:|.|||||||.|.||.|||...:.|.:. ::....::.:|:
Human   565 QYARS---TCEAGVAELHIQDALPEDHGTYTCLAENALGQVSCSAWVTVHEK-KSSRKSEYLLPV 625

  Fly  6548 DPFY----IF---------REGSEIRLSTKVEAYPSVGVTWHRNGMRLRPSRRLTATLDSNG-YV 6598
            .|..    ||         .:||::.::.:|...|...|.|..||..::.|...  ..:..| ..
Human   626 APSKPTAPIFLQGLSDLKVMDGSQVTMTVQVSGNPPPEVIWLHNGNEIQESEDF--HFEQRGTQH 688

  Fly  6599 ELIIAEATVRDAGIYVCVASNVVGKVETICRVAVEEAENKAVAPQRSLEIPSIKTDDLPYSKEPL 6663
            .|.|.|....|.|.|.|.|.|..|:|.|...:.|:|..:                     ..:|.
Human   689 SLCIQEVFPEDTGTYTCEAWNSAGEVRTQAVLTVQEPHD---------------------GTQPW 732

  Fly  6664 FVVKPRSSEAYEGDNVIIFCEVVGDPKPEVVWLRDFLNPEYYKDAPHFRRIGDGPEYRLEIPSAK 6728
            |:.||||..|..|.:|:|.|.:.|||.|.|.||||  .....||..||..:.:...:.|.:...:
Human   733 FISKPRSVTASLGQSVLISCAIAGDPFPTVHWLRD--GKALCKDTGHFEVLQNEDVFTLVLKKVQ 795

  Fly  6729 LDFTGTYSVIASNCHGEAKAVISLQIFAKDILNKSRMDKVHTRHGNIETLPRFVRNLRNLRCCDG 6793
            ....|.|.::..|..||....:||.:                ::.:...|||             
Human   796 PWHAGQYEILLKNRVGECSCQVSLML----------------QNSSARALPR------------- 831

  Fly  6794 DAISLECHVEADPEPFIIWEKDGHVMPSDRDYVMSFDGTKATLSIPRVYPEDEGEYTCVAKNSVG 6858
                                                                            |
Human   832 ----------------------------------------------------------------G 832

  Fly  6859 RSLSSACIIVDVPEEKENMLSRQLARPSGLLSAHSTPRSTPRSTPARSFSPLRLSYRTSSIDLSG 6923
            |.          |...|::....:....|....:.:.|.   ..|||....|.   .....|:.|
Human   833 RE----------PASCEDLCGGGVGADGGGSDRYGSLRP---GWPARGQGWLE---EEDGEDVRG 881

  Fly  6924 VAERR---RSDARNAITAPKFLAIPYNRVVEEGDSVRFQCAISGHPTPWATWDKDGLIVTPTPRI 6985
            |.:||   |.....||..            :|.:.:.|:..:.                   .::
Human   882 VLKRRVETRQHTEEAIRQ------------QEVEQLDFRDLLG-------------------KKV 915

  Fly  6986 AVKEI--DDLRIIEIDEVTFDDAGLYR----VTLENDFGRIEATARLDVIRSSRYSKSPSVRSVR 7044
            :.|.:  |||:.|..:::.| .|.|.|    .|:..:..::.:..::|            .|||.
Human   916 STKTLSEDDLKEIPAEQMDF-RANLQRQVKPKTVSEEERKVHSPQQVD------------FRSVL 967

  Fly  7045 ASSSRRNAHLYRRIMGPSTA-------IGGRMALASGYRGSSVPSVRFYHNDVELEASERVHILL 7102
            |........:..::..|..|       :||:..|.:....||..::    |...:|:|:.:. ..
Human   968 AKKGTSKTPVPEKVPPPKPATPDFRSVLGGKKKLPAENGSSSAETL----NAKAVESSKPLS-NA 1027

  Fly  7103 QDSMALLIVDNV-----------------------TREDEGQYTCI-------ISGDHDPLITST 7137
            |.|..|..|.|.                       .:.||...:..       :..|.:......
Human  1028 QPSGPLKPVGNAKPAETLKPMGNAKPAETLKPMGNAKPDENLKSASKEELKKDVKNDVNCKRGHA 1092

  Fly  7138 TVTFHDSNTEIRRRRAVITERLPEITKSLEGEVIDLCCSIECDEPYSYVWLRNGEILPDSDEFNY 7202
            ..|.::..:|.:.......::|.::..: ||:.:.|.|.:..|.|.:.:|..||:.| .:.:|..
Human  1093 GTTDNEKRSESQGTAPAFKQKLQDVHVA-EGKKLLLQCQVSSDPPATIIWTLNGKTL-KTTKFII 1155

  Fly  7203 IDHGNGRLC-LRINDAFDIDSGIYSCQVFTSDINDSTSDSTFDSHSICSLINSGCSDCSSSGELC 7266
            :.. .|.|| :.|..|...|.|:|.| |..:|                    :|.::||      
Human  1156 LSQ-EGSLCSVSIEKALPEDRGLYKC-VAKND--------------------AGQAECS------ 1192

  Fly  7267 VLERDLRGQDEECVQLLKTPLPVVCASGDEALFYARVFPCDAEADWYLNGQLLAQADDSLNMTLE 7331
                                                   |....|                    
Human  1193 ---------------------------------------CQVTVD-------------------- 1198

  Fly  7332 SYPENGIRLLRMRDVTASRSGEICLQVKHPQAEFRRIPTTRTYTSLLVLPAIRGNSSSSSLAARS 7396
                         |..||.:      .|.|:.:.||..::        ||.:.|..|.:::..:.
Human  1199 -------------DAPASEN------TKAPEMKSRRPKSS--------LPPVLGTESDATVKKKP 1236

  Fly  7397 C------------ILTRPEDCTALIGGHVRLSVRYEPFPGTKVI---WYKACHPIVESSNVTIRT 7446
            .            |:..|||.....|..|.|   :....||:.|   |.|....|.||.::.:..
Human  1237 APKTPPKAAMPPQIIQFPEDQKVRAGESVEL---FGKVTGTQPITCTWMKFRKQIQESEHMKVEN 1298

  Fly  7447 TSQQSTLYITDISADDSGKYTVEVMNDYGVEAAAASVAVEGPPEPPSGQPSVS-LGPDRVAVAWC 7510
            :...|.|.|.....:..|.||:.|.|..|...|..::.|...|:||:|.|..| :....:.::|.
Human  1299 SENGSKLTILAARQEHCGCYTLLVENKLGSRQAQVNLTVVDKPDPPAGTPCASDIRSSSLTLSWY 1363

  Fly  7511 GPPYDGGCMITGFIIEMQTIGDENCDEDSWQQVTRVVDSLAYTVKNLQPERQYRFRVRAENIHGR 7575
            |..||||..:..:.||:....::     :|:::. ...|.::.|::|.|:.:|:|||||.|::|.
Human  1364 GSSYDGGSAVQSYSIEIWDSANK-----TWKELA-TCRSTSFNVQDLLPDHEYKFRVRAINVYGT 1422

  Fly  7576 SAPGQASELVQITNTPQR-------STSSDASDRFGQATVSVQSGGDFKSRFEIIEELGKGRFGI 7633
            |.|.|.|||..:...|:.       |...:........||::.:.......::|.|.||.|:||.
Human  1423 SEPSQESELTTVGEKPEEPKDEVEVSDDDEKEPEVDYRTVTINTEQKVSDFYDIEERLGSGKFGQ 1487

  Fly  7634 VYKVQERGQPEQLLAAKVIKCIKSQDRQKVLEEISIMRALQHPKLLQLAASFESPREIVMVMEYI 7698
            |:::.|: :..::.|.|..|...:::::.:.:|||||..|.||||:|...:||....||||:|.:
Human  1488 VFRLVEK-KTRKVWAGKFFKAYSAKEKENIRQEISIMNCLHHPKLVQCVDAFEEKANIVMVLEIV 1551

  Fly  7699 TGGELFERVVADDFTLTEMDCILFLRQVCDGVAYMHGQSVVHLDLKPENIMCHTRTSHQIKIIDF 7763
            :|||||||::.:||.|||.:||.::||:.:||.|:|.|.:||||||||||||..:|..:||:|||
Human  1552 SGGELFERIIDEDFELTERECIKYMRQISEGVEYIHKQGIVHLDLKPENIMCVNKTGTRIKLIDF 1616

  Fly  7764 GLAQRLDTKAPVRVLFGTPEFIPPEIISYEPIGFQSDMWSVGVICYVLLSGLSPFMGDTDVETFS 7828
            |||:||:....::||||||||:.||:|:|||||:.:||||:|||||:|:|||||||||.|.||.:
Human  1617 GLARRLENAGSLKVLFGTPEFVAPEVINYEPIGYATDMWSIGVICYILVSGLSPFMGDNDNETLA 1681

  Fly  7829 NITRADYDYDDEAFDCVSQEAKDFISQLLVHRKEDRLTAQQCLASKWLSQRPDDSLSNNKICTDK 7893
            |:|.|.:|:||||||.:|.:||||||.||....::||...|||...|| .:...::...|:..|:
Human  1682 NVTSATWDFDDEAFDEISDDAKDFISNLLKKDMKNRLDCTQCLQHPWL-MKDTKNMEAKKLSKDR 1745

  Fly  7894 LKKFIIRRKWQKTGNAIRALGRMANLSVSRRNSAIAMGVLSSPRPSISGLGMLTTSAIGSGTSSQ 7958
            :||::.||||||||||:||:||::::::                  ||||.. ..|:.||.||..
Human  1746 MKKYMARRKWQKTGNAVRAIGRLSSMAM------------------ISGLSG-RKSSTGSPTSPL 1791

  Fly  7959 MTSLHEEEDDFS--------GEMPPVEKRTVLKLRD---------KSQC---------------- 7990
            .....|.|:|.|        .|.|.|:......:||         :..|                
Human  1792 NAEKLESEEDVSQAFLEAVAEEKPHVKPYFSKTIRDLEVVEGSAARFDCKIEGYPDPEVVWFKDD 1856

  Fly  7991 -----SERSDSGYSECSNCS 8005
                 |......|.|..|||
Human  1857 QSIRESRHFQIDYDEDGNCS 1876

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Strn-MlckNP_001261019.1 Ig_3 26..112 CDD:464046
Ig <70..112 CDD:472250
Ig strand E 92..96 CDD:409353
Ig strand F 106..111 CDD:409353
Ig 137..226 CDD:472250
Ig strand B 154..158 CDD:409353
Ig strand C 167..171 CDD:409353
Ig strand E 192..196 CDD:409353
Ig strand F 206..211 CDD:409353
Ig strand G 219..222 CDD:409353
Ig 235..314 CDD:472250
Ig strand B 251..255 CDD:409564
Ig strand C 264..268 CDD:409564
Ig strand E 280..284 CDD:409564
Ig strand F 294..299 CDD:409564
Ig strand G 307..310 CDD:409564
Ig_3 336..414 CDD:464046
Ig 438..513 CDD:472250
Ig strand B 454..458 CDD:409564
Ig strand C 467..471 CDD:409564
Ig strand E 483..487 CDD:409564
Ig strand F 493..498 CDD:409564
Ig strand G 506..509 CDD:409564
Ig 537..628 CDD:472250
Ig strand B 554..558 CDD:409353
Ig strand C 567..571 CDD:409353
Ig strand F 607..612 CDD:409353
Ig strand G 620..623 CDD:409353
Ig 636..713 CDD:472250
Ig strand B 652..656 CDD:409564
Ig strand C 665..669 CDD:409564
Ig strand E 681..685 CDD:409564
Ig strand F 695..700 CDD:409564
Ig strand G 708..711 CDD:409564
SMC_N <2131..2664 CDD:481474
PTZ00121 <2600..3256 CDD:173412
PTZ00121 <3635..4609 CDD:173412
PTZ00121 <4215..5072 CDD:173412
I-set 5300..5388 CDD:400151
Ig strand B 5317..5321 CDD:409353
Ig strand C 5329..5333 CDD:409353
Ig strand E 5354..5358 CDD:409353
Ig strand F 5368..5373 CDD:409353
Ig_3 5399..5477 CDD:464046
Ig 5542..5627 CDD:472250
Ig strand B 5556..5560 CDD:409353
Ig strand C 5568..5572 CDD:409353
Ig strand E 5593..5597 CDD:409353
Ig strand F 5607..5612 CDD:409353
Ig 5654..5721 CDD:409353
Ig strand B 5654..5658 CDD:409353
Ig strand C 5665..5669 CDD:409353
Ig strand E 5690..5694 CDD:409353
Ig strand F 5704..5709 CDD:409353
Ig strand G 5718..5721 CDD:409353
I-set 5784..5874 CDD:400151
Ig strand B 5801..5805 CDD:409353
Ig strand C 5814..5818 CDD:409353
Ig strand E 5840..5844 CDD:409353
Ig strand F 5854..5859 CDD:409353
Ig 5902..5963 CDD:409353 20/60 (33%)
Ig strand B 5902..5906 CDD:409353 0/3 (0%)
Ig strand C 5915..5919 CDD:409353 0/3 (0%)
Ig strand E 5941..5945 CDD:409353 1/3 (33%)
Ig strand F 5955..5960 CDD:409353 2/4 (50%)
Ig 5997..6086 CDD:472250 10/88 (11%)
Ig strand B 6014..6018 CDD:409353 0/3 (0%)
Ig strand C 6028..6032 CDD:409353 0/3 (0%)
Ig strand E 6050..6056 CDD:409353 0/5 (0%)
Ig strand F 6066..6071 CDD:409353 0/4 (0%)
Ig strand G 6079..6082 CDD:409353 0/2 (0%)
Ig 6107..6187 CDD:472250 22/96 (23%)
Ig strand B 6115..6119 CDD:409353 0/3 (0%)
Ig strand C 6128..6132 CDD:409353 1/3 (33%)
Ig strand E 6153..6157 CDD:409353 0/3 (0%)
Ig strand F 6167..6172 CDD:409353 1/4 (25%)
Ig strand G 6180..6183 CDD:409353 1/2 (50%)
FN3 6216..6310 CDD:238020 25/123 (20%)
I-set 6321..6412 CDD:400151 22/90 (24%)
Ig strand B 6339..6343 CDD:409353 0/3 (0%)
Ig strand C 6352..6356 CDD:409353 1/3 (33%)
Ig strand E 6375..6382 CDD:409353 1/6 (17%)
Ig strand F 6392..6397 CDD:409353 2/4 (50%)
Ig strand G 6405..6408 CDD:409353 1/2 (50%)
I-set 6442..6531 CDD:400151 32/88 (36%)
Ig strand B 6459..6463 CDD:409353 1/3 (33%)
Ig strand C 6472..6476 CDD:409353 1/3 (33%)
Ig strand E 6497..6501 CDD:409353 1/3 (33%)
Ig strand F 6511..6516 CDD:409353 4/4 (100%)
Ig strand G 6524..6527 CDD:409353 2/2 (100%)
Ig 6541..6632 CDD:472250 26/104 (25%)
Ig strand B 6559..6563 CDD:409353 0/3 (0%)
Ig strand C 6572..6576 CDD:409353 1/3 (33%)
Ig strand E 6598..6602 CDD:409353 1/3 (33%)
Ig strand F 6612..6617 CDD:409353 2/4 (50%)
Ig strand G 6625..6628 CDD:409353 1/2 (50%)
Ig 6662..6754 CDD:472250 32/91 (35%)
Ig strand B 6679..6683 CDD:409353 2/3 (67%)
Ig strand C 6692..6696 CDD:409353 1/3 (33%)
Ig strand E 6720..6724 CDD:409353 1/3 (33%)
Ig strand F 6734..6739 CDD:409353 1/4 (25%)
I-set 6779..6868 CDD:400151 4/88 (5%)
Ig strand B 6796..6800 CDD:409353 0/3 (0%)
Ig strand C 6809..6813 CDD:409353 0/3 (0%)
Ig strand E 6834..6838 CDD:409353 0/3 (0%)
Ig strand F 6848..6853 CDD:409353 0/4 (0%)
I-set 6939..7028 CDD:400151 12/94 (13%)
Ig strand B 6956..6960 CDD:409353 1/3 (33%)
Ig strand C 6969..6973 CDD:409353 0/3 (0%)
Ig strand E 6993..6998 CDD:409353 2/4 (50%)
Ig strand F 7008..7013 CDD:409353 2/8 (25%)
Ig strand G 7021..7024 CDD:409353 0/2 (0%)
IG_like 7075..7140 CDD:214653 13/94 (14%)
Ig strand C 7082..7086 CDD:409353 0/3 (0%)
Ig strand E 7107..7111 CDD:409353 1/3 (33%)
Ig strand F 7121..7126 CDD:409353 0/11 (0%)
Ig strand G 7135..7138 CDD:409353 0/2 (0%)
Ig 7173..7232 CDD:409353 19/59 (32%)
Ig strand C 7184..7188 CDD:409353 0/3 (0%)
Ig strand E 7210..7214 CDD:409353 2/4 (50%)
Ig strand F 7224..7229 CDD:409353 2/4 (50%)
IG_like 7406..7475 CDD:214653 19/71 (27%)
Ig strand B 7413..7417 CDD:409353 2/3 (67%)
Ig strand C 7426..7430 CDD:409353 1/6 (17%)
Ig strand E 7451..7455 CDD:409353 2/3 (67%)
Ig strand F 7465..7470 CDD:409353 2/4 (50%)
FN3 7489..7588 CDD:238020 33/99 (33%)
STKc_MLCK 7626..7876 CDD:271005 134/249 (54%)
MYLKXP_024309300.1 I-set 43..133 CDD:400151 25/92 (27%)
Ig strand B 60..64 CDD:409353 0/3 (0%)
Ig strand C 73..77 CDD:409353 0/3 (0%)
Ig strand E 99..103 CDD:409353 1/3 (33%)
Ig strand F 113..118 CDD:409353 2/4 (50%)
Ig strand G 126..129 CDD:409353 0/2 (0%)
I-set 171..260 CDD:400151 20/89 (22%)
Ig strand B 188..192 CDD:409353 0/3 (0%)
Ig strand C 201..205 CDD:409353 1/3 (33%)
Ig strand E 226..230 CDD:409353 0/3 (0%)
Ig strand F 240..245 CDD:409353 1/4 (25%)
Ig strand G 253..256 CDD:409353 0/2 (0%)
23ISL 261..422 CDD:435470 35/177 (20%)
I-set 424..514 CDD:400151 22/90 (24%)
Ig strand B 441..445 CDD:409543 0/3 (0%)
Ig strand C 454..458 CDD:409543 1/3 (33%)
Ig strand E 480..484 CDD:409543 1/3 (33%)
Ig strand F 494..499 CDD:409543 2/4 (50%)
Ig strand G 507..510 CDD:409543 1/2 (50%)
IgI_4_MYLK-like 523..610 CDD:409568 33/101 (33%)
Ig strand A 523..526 CDD:409568 2/14 (14%)
Ig strand A' 532..535 CDD:409568 1/2 (50%)
Ig strand B 540..548 CDD:409568 2/7 (29%)
Ig strand C 554..558 CDD:409568 1/3 (33%)
Ig strand C' 561..564 CDD:409568 0/2 (0%)
Ig strand D 568..572 CDD:409568 1/6 (17%)
Ig strand E 576..581 CDD:409568 1/4 (25%)
Ig strand F 589..597 CDD:409568 7/7 (100%)
Ig strand G 600..610 CDD:409568 4/9 (44%)
IgI_4_hemolin-like 633..722 CDD:409570 24/90 (27%)
Ig strand A 633..636 CDD:409570 1/2 (50%)
Ig strand A' 642..645 CDD:409570 0/2 (0%)
Ig strand B 650..657 CDD:409570 0/6 (0%)
Ig strand C 663..668 CDD:409570 2/4 (50%)
Ig strand C' 671..673 CDD:409570 0/1 (0%)
Ig strand D 678..682 CDD:409570 0/5 (0%)
Ig strand E 688..692 CDD:409570 1/3 (33%)
Ig strand F 701..709 CDD:409570 4/7 (57%)
Ig strand G 712..722 CDD:409570 3/9 (33%)
I-set 731..819 CDD:400151 30/89 (34%)
Ig strand B 748..752 CDD:409353 2/3 (67%)
Ig strand C 761..765 CDD:409353 1/3 (33%)
Ig strand E 787..791 CDD:409353 1/3 (33%)
Ig strand F 801..806 CDD:409353 1/4 (25%)
Ig strand G 814..817 CDD:409353 0/2 (0%)
I-set 1108..1197 CDD:400151 27/157 (17%)
Ig strand B 1125..1129 CDD:409353 1/3 (33%)
Ig strand C 1138..1142 CDD:409353 0/3 (0%)
Ig strand E 1163..1167 CDD:409353 1/3 (33%)
Ig strand F 1177..1182 CDD:409353 2/5 (40%)
Ig strand G 1190..1193 CDD:409353 2/47 (4%)
IgI_8_hMLCK_like 1247..1345 CDD:409419 28/100 (28%)
Ig strand A 1247..1251 CDD:409419 0/3 (0%)
Ig strand A' 1256..1260 CDD:409419 1/3 (33%)
Ig strand B 1264..1273 CDD:409419 2/11 (18%)
Ig strand C 1277..1283 CDD:409419 2/5 (40%)
Ig strand C' 1286..1288 CDD:409419 0/1 (0%)
Ig strand D 1294..1299 CDD:409419 0/4 (0%)
Ig strand E 1303..1308 CDD:409419 2/4 (50%)
Ig strand F 1316..1324 CDD:409419 4/7 (57%)
Ig strand G 1327..1337 CDD:409419 2/9 (22%)
FN3 1341..1433 CDD:238020 33/97 (34%)
STKc_MLCK1 1471..1729 CDD:271093 136/258 (53%)
IgI_telokin-like 1822..1909 CDD:409565 9/55 (16%)
Ig strand A 1822..1825 CDD:409565 0/2 (0%)
Ig strand A' 1827..1830 CDD:409565 1/2 (50%)
Ig strand B 1834..1843 CDD:409565 1/8 (13%)
Ig strand C 1848..1854 CDD:409565 0/5 (0%)
Ig strand C' 1857..1859 CDD:409565 0/1 (0%)
Ig strand D 1865..1870 CDD:409565 0/4 (0%)
Ig strand E 1873..1881 CDD:409565 3/4 (75%)
Ig strand F 1889..1896 CDD:409565
Ig strand G 1899..1909 CDD:409565
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.