DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Strn-Mlck and dpr10

Sequence 1:NP_001261019.1 Gene:Strn-Mlck FlyBaseID:FBgn0265045 Length:8255 Species:Drosophila melanogaster
Sequence 2:NP_729591.1 Gene:dpr10 FlyBaseID:FBgn0052057 Length:408 Species:Drosophila melanogaster

Alignment Length:309 Identity:62/310 (20%)
Similarity:111/310 (36%) Gaps:97/310 (31%)


  Fly  5210 SKAKSKPDGLPADEKSHGAKVSESVPVKNEAEKTDQLSAKKPTVLDEDLVVPKRKPYLAEQTADS 5274
            :.|::||...|.....||.|.:|..                     .||.:|:....|..::|  
  Fly    30 NNAEAKPTHAPPSHYPHGHKWNEPY---------------------FDLTMPRNITSLVGKSA-- 71

  Fly  5275 ISLQTYKSMDSEYKDRKESRSAKRKPTVDIQLTNRNTASGSDLKLTCGLSGHEMNVQWFKDNCPI 5339
                 |.....::...|.....:.:   |:.:            ||.|...:..: |.|:     
  Fly    72 -----YLGCRVKHLGNKTVAWIRHR---DLHI------------LTVGTYTYTTD-QRFQ----- 110

  Fly  5340 ENGAKYRRTLNDGLSCLEIKSAELGDSGIYRCIASNQNG-------------EVETSCLV----- 5386
               ..|.|.:::.  .|:||.|:..|:|:|.|..|.|..             :.|||.::     
  Fly   111 ---TSYHRDIDEW--TLQIKWAQQRDAGVYECQISTQPVRSYSVNLNIVDLIDAETSDIMQQYYN 170

  Fly  5387 ---------TIYEAPSSKFG-------TPPIFTRNI---RDAYHSQGNQLTLECKVSGSPKP--H 5430
                     .:|::.:.:|.       |..:.|..|   .|.|..:|:.:.|.|.:..||:|  |
  Fly   171 DDAFYIAENRVYQSSNDEFAGMFGPIQTVAVPTATILGGPDLYVDKGSTINLTCIIKFSPEPPTH 235

  Fly  5431 IYWQRDNTLLPIEGT----KYQYEEQSDGIKLLTINNFGSNDSGLYTCY 5475
            |:|...:.:|..|.:    |::..:..:...:|.|.:.....||.|:||
  Fly   236 IFWYHQDKVLSEETSGGRLKFKTIKSEETKSILLIYDADLLHSGKYSCY 284

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Strn-MlckNP_001261019.1 IG_like 51..127 CDD:214653
Ig <69..>112 CDD:299845
I-set 137..226 CDD:254352
I-set 235..314 CDD:254352
Ig_2 244..314 CDD:290606
I-set 438..513 CDD:254352
Ig 454..510 CDD:143165
I-set 537..626 CDD:254352
Ig 555..618 CDD:299845
I-set 636..713 CDD:254352
Ig 652..712 CDD:143165
SMC_N <2190..2854 CDD:280601
I-set 5300..5388 CDD:254352 21/115 (18%)
IGc2 5313..5378 CDD:197706 17/65 (26%)
IG 5412..5482 CDD:214652 19/71 (27%)
IGc2 5413..5481 CDD:197706 19/70 (27%)
I-set 5542..5627 CDD:254352
Ig 5556..5621 CDD:143165
Ig 5654..5721 CDD:143165
I-set 5784..5874 CDD:254352
IGc2 5797..5864 CDD:197706
I-set 5887..5970 CDD:254352
Ig 5902..5966 CDD:143165
I-set 5997..6086 CDD:254352
Ig 6026..6083 CDD:143165
I-set 6097..6187 CDD:254352
Ig 6114..6187 CDD:299845
FN3 6216..6310 CDD:238020
I-set 6321..6412 CDD:254352
Ig 6328..6412 CDD:299845
I-set 6442..6531 CDD:254352
Ig 6459..6528 CDD:143165
I-set 6541..6632 CDD:254352
IGc2 6555..6622 CDD:197706
I-set 6662..6754 CDD:254352
Ig 6679..6751 CDD:143165
I-set 6779..6868 CDD:254352
IGc2 6793..6858 CDD:197706
Ig 6938..7022 CDD:299845
I-set 6939..7028 CDD:254352
IG 7075..7140 CDD:214652
Ig 7075..7140 CDD:143165
IG 7167..7239 CDD:214652
Ig 7173..7239 CDD:143165
Ig 7392..7475 CDD:299845
IG 7406..7475 CDD:214652
FN3 7489..7588 CDD:238020
S_TKc 7620..7876 CDD:214567
STKc_MLCK 7626..7876 CDD:271005
dpr10NP_729591.1 Ig 63..143 CDD:299845 22/113 (19%)
IG_like 210..297 CDD:214653 21/76 (28%)
IGc2 217..287 CDD:197706 19/69 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.