DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Strn-Mlck and Obsc

DIOPT Version :10

Sequence 1:NP_001261019.1 Gene:Strn-Mlck / 36753 FlyBaseID:FBgn0265045 Length:8255 Species:Drosophila melanogaster
Sequence 2:NP_001097440.1 Gene:Obsc / 3346201 FlyBaseID:FBgn0053519 Length:4218 Species:Drosophila melanogaster


Alignment Length:4056 Identity:846/4056 - (20%)
Similarity:1470/4056 - (36%) Gaps:1007/4056 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly  4257 KEKQTES-AIDEKS-QKAEVSEIVSEKITEEKAQESQKKEVK--DSKAKPKKA----KVLE---- 4309
            ::.|.:| |.||.| .:.::.|::|     .||.|..:..|:  ||...||:.    .:||    
  Fly    12 RDYQAQSLATDEISVSRGDLVELIS-----SKASEKSRCFVRMFDSGDSPKEGWVPIDILEFNPT 71

  Fly  4310 ---KKSIEEAKLEDKK--------ETQTDSAID-----EKSQKAEVSEIVSEKITDEK------- 4351
               ....|....|.:|        ||:.:.:.|     ||..|.....:|...:.|.|       
  Fly    72 MSSSNGKESGDAEFRKLTILRELVETEEEFSRDLLHVVEKYIKGIDKPVVPRSVRDNKDIIFCNF 136

  Fly  4352 AQESQ------KEEVKDSEAKPK---KAKVLEKKSIEEEKLENKKEKQTESAIDEKSQKAEVSEI 4407
            .|.::      ||.:|....:|.   |..:..::..::..:..:.|...:..:.......:..:.
  Fly   137 LQIAEFHNNVLKEGLKCYSNQPNMVAKTFLRLERDFDKHVVYCQNEPLAQDYLGSSPDAKKYFQE 201

  Fly  4408 VSEKITDEKAQESQKKEVKGSEAKPKKAKVLEKKSIEEEKLEDKKEKQTESAIDEKSQKAEVSEI 4472
            :|:::.|:|   |..:.:|....:....::|.|..|:......:..|..|.|:       |:...
  Fly   202 LSKQLGDDK---SLAEHLKLPIQRINDYQLLFKDFIKYSLSLKENVKDLERAL-------ELMLS 256

  Fly  4473 VSEKITDEKAQESQKE-----------------EVKDSEAK---------------PKKAKVLEK 4505
            |..:..|.:...|.:.                 .|.|.|.|               .|..|:.|.
  Fly   257 VPSRAYDNRFLSSIEGCRGNIYKLGRLLLHAWCNVVDKEGKAHDRYCFLFKSRILVTKVRKISEN 321

  Fly  4506 KSI-------------EEAKLEDKK--------ETQTDSAIDEKSQKAEV-----SEIVSEKITD 4544
            :|:             .|.|.::|:        |..:...||.|....|.     :||.|....|
  Fly   322 RSVFILQNIVKLPLCNIELKADEKQIHLSLKAPEANSFLPIDIKPHGPEAHLTWFNEISSHINQD 386

  Fly  4545 EKAQESQKEEVK-DSEAKPKKAKVLEKKSIEEAKLEDKKETQTDSAIDEKSQKAEVSEIVSEKIT 4608
            ...||...:::| |:.....:::::       ..|..:.|....:.....|..||  .....|.|
  Fly   387 VTLQEHNADDLKVDASQIASESELI-------LHLPQRAEAHDPNLSVRPSDVAE--NYFLSKET 442

  Fly  4609 DEKAQESQKEEVKDSEAKPKKAKVLEKKSIEEEKLEDKKEKQTESAIDEKSQKAEVSEIVSEKIT 4673
            .|:.|..|:|.:|                :|:|.:|..|::|:..::..|::..|::        
  Fly   443 KERLQHEQQELLK----------------LEQEAIELYKKQQSSKSVSSKTESVEIT-------- 483

  Fly  4674 DEKAQESQMEEVKD--SEAKPKKAKVLEKKSIEEAKLEDK----KETQTDSAIDEKSQKAEVSEI 4732
              .:|.....||:.  |...|.:|:|   |.:...|:...    ||...........|...|:..
  Fly   484 --SSQVKSSSEVRKVVSPPPPPQAQV---KEVTPVKVVSSPPPPKEITPAKVATPPPQPQVVTSP 543

  Fly  4733 VSEKI--TDEKAQESQKEEVKDSEAKPKKAKVLEKKSIEEEKLEDKKEKQTESAIDEKSQKAEVS 4795
            |.|..  ...:|..|..:||..|:::|.||                              .:.:.
  Fly   544 VKEVAPPPQPRAVASPAKEVTPSQSEPVKA------------------------------PSPIK 578

  Fly  4796 EIVSEKITDEKAQESQKKEVKGSEAKPKKAKVLEKKSIEEEKLEDKKEKQTESAIDEKSQKAEV- 4859
            |:              :|||..|.:..|:.:.|....|.|...|      |.|.:.|..|.:|: 
  Fly   579 EV--------------RKEVPPSASHSKEVEALVATEIRESLTE------TRSTVVESGQSSEIR 623

  Fly  4860 SEIVSEKITDEKAQESQKKEVKDSEAKPKKAKVLEKKSIEEEKLENKKEKQTESAIDEKSQKAEV 4924
            .|||   :|:|.:.|.  |:|...|.:|....:        .|::..:..:.|:.:..|.:..|:
  Fly   624 EEIV---VTEESSLEG--KQVVALEREPSPCSI--------PKIQVYRPVECENPVVTKHKPIEL 675

  Fly  4925 SEIV--SEKITDEKA---------QESQKKEVKDSEA----KPKKAKVLEKKSIEEEKLEDKKEK 4974
            .:||  ||.:.|...         |:.....:.|..:    ..:.|.:...:|...:.|:  :..
  Fly   676 KDIVGYSESLRDGDTAPAGGSPGRQQGYSANITDHASLTIWNNRLANIAGDRSGANQHLQ--QSG 738

  Fly  4975 QTESAIDEKFQKAEVSETVSEKITDEKAEESRKEEVKDSEAKPKKAKVLEKKSIEEEKLEDKKEK 5039
            .....|...|.:..........|..|...|....:.:.....|.....:::..:..|.||.|.:.
  Fly   739 PPPPPIPPNFTRMPGFFQPLPLIAYETTIEILIVKARPPSPPPPPPPTIKRVLVHTESLEQKTQN 803

  Fly  5040 QTESAIDEKSQKAEVSETVSEKITDEKAQESQKKE----VKDSEAKPKKAKILEKKSIEIEKLDE 5100
            ..|...|..|....: ....:||...|:...:.|:    .:|:..|.|....|...:..::|   
  Fly   804 FFEGIYDAASSDTSL-RNAKQKIRSIKSTVLKSKDSTNYAQDTVQKAKARDFLHIFTPPVKK--- 864

  Fly  5101 KKEKQTETKVATDTKSQTVEVSEI---VLEKISEEKAEESQKVELKDSEAKSKKAKVLE------ 5156
                    :...:...:.|.:.|:   ..|.|:::..|.|     .|.||:.:....::      
  Fly   865 --------RPIYEIVEEPVNIFELEGDYTESIADDFREPS-----ADFEARGQSVGGMDDYYSGY 916

  Fly  5157 -KKST--LKEKLDENDKKQKEDGATNKSQKAEAADVVPEKISEEKV-----------AEIKTPEP 5207
             :.||  .:.|..:.|:....|....:||...::.  .::.|.:||           .|.:....
  Fly   917 SRASTRRYETKTRDYDRGTSYDSTVERSQYGISSR--RDRSSVDKVEARSSLLATGRTESRAASR 979

  Fly  5208 MDSKAKSKPDGLPADEKS---HGAKVSESVPVKNEAEKTDQLSAKKPTVLDEDLVVPKRKPYLAE 5269
            .:|:|:|:.....|:.::   ..:::.|..|:::               :|:.:||...|....|
  Fly   980 AESRAESRASYSVAESRAGIRSSSRLQEDRPLRS---------------VDKPVVVKMLKSVQVE 1029

  Fly  5270 --QTADSISLQTYKSMDSEYKDRKESRSAKRKPTVDIQLTNRNTASGSDLKLTCGLSGHEMNVQW 5332
              :||         ..:.::||:.                              ||      |.|
  Fly  1030 PGETA---------HFEIQFKDQP------------------------------GL------VTW 1049

  Fly  5333 FKDNCPIENGAKYRRT-----LNDGLSCLEIKSAELGDSGIYRCIASNQNGEVETSCLVTIYEAP 5392
            .|||.|:|:....|.|     :|.  ..|:||:....|:|.|...|.:.:.....|..:.:.:||
  Fly  1050 LKDNKPLEDRLADRITQTAAPMNS--YRLDIKNCSETDAGTYTIRAQSASETTTVSAQLAVGQAP 1112

  Fly  5393 ---SSKFGTPPIFTRNIRDAYHSQGNQLTLECKVSGSPKPHIYWQRDNTLLPIEGTKYQYEEQSD 5454
               .:|..|.|.|..:::||...:........|:.|.|||.:.:.:|...:.....:.|.....|
  Fly  1113 GHDETKTNTEPAFLVSLKDAEMIENTLFRFMVKIIGDPKPRVKFYKDEKEILETNDRIQIIRDKD 1177

  Fly  5455 --GIKLLTINNFGSNDSGLYTCYAESENGQMKISKFVQASDYVRERIADKKPIDKVIQEIKRDES 5517
              |...|.|.:....|:|.|:|.|.:::|:..       .:.:...:.||.|..           
  Fly  1178 YLGFYELVIADVQKTDAGTYSCKATNKHGEAN-------CEAIATTVEDKNPFG----------- 1224

  Fly  5518 SSAAANDTAAAKAKAREAKLRLNLETSLKTMTIGSGNKAQLICYVTGIIEDVHWLRNDERVTKDA 5582
                                      :|....:.:|.|...           .|.||.|....:.
  Fly  1225 --------------------------ALSGQILPAGEKPVF-----------QWKRNGEEFDPEE 1252

  Fly  5583 RHKIY--NINGAISLEIYDARVEDSGHYRCVVKNSRQTVESAGQLSVLD--QSTGKLPES----- 5638
            |.|:.  ....:::|.....:.||:|.|.||.:.|...:..:.:|||..  |:..:.||.     
  Fly  1253 RFKVLFGEDEDSLALVFQHVKPEDAGIYTCVAQTSTGNISCSAELSVQGAIQTLNREPEKPTLVI 1317

  Fly  5639 ---------FSSGIIESYDDQRNEIVLSCQVIGRPSVSWMRDDHSI-CNNRYRTIEEPGGVRKLV 5693
                     ..|.|:|          |.|:...:|:|.|..|...| .::|::.:.|......||
  Fly  1318 EHREANASIGGSAILE----------LQCKGFPKPAVQWKHDGEVIQVDDRHKFMYEDEESMSLV 1372

  Fly  5694 IRNPISSDCGIFACYAEHEDRIDSTSI--TIKA-ADLKRLINVS-------QEEIPSIGDHESTP 5748
            |:|..:.|.|::...|.:|...|.:||  .:|| ..:|::.:::       :.||...|..:.| 
  Fly  1373 IKNVDTVDAGVYTIEAINELGQDESSINLVVKAPPKIKKITDITCSAGETIKMEIEVEGFPQPT- 1436

  Fly  5749 WSRSQSHLSSGSQVNGNG------------------------------ELHRAGDRVLRNVG--- 5780
                       .||..||                              :|.:||:..::...   
  Fly  1437 -----------VQVTNNGKDVTAESNVKISSSSIGKSLEKVVVEVKEIKLSQAGNYSIKATNDLS 1490

  Fly  5781 ----------KGKPLFHTLLHDRTV-SEGANLRLVCSVSGDENTHIEWLKNHKPLPRSDNRYQTV 5834
                      |.||:.........: .|..|:::...:.......:.|..:...:..:|::| ||
  Fly  1491 QTSEYWSCTVKSKPVIVKNFESEYIHGEKENVQMTVRIDAYPEAKLTWYHDETEIKITDSKY-TV 1554

  Fly  5835 YLNGEA-SLEIFAAVADDSGNYTCCATNDFGESLTHAQLRVYKNFKEAPLPSTFTQPIRD-TYSL 5897
            ..:|.| :|:|..|...|:|.||..|||:.|.:.:..||.:    |.||   .||..::: |.:.
  Fly  1555 SSDGNAYTLKITGATRVDAGKYTVKATNEHGSATSSTQLLI----KCAP---EFTHKLKNITVAE 1612

  Fly  5898 NENELVLDCRVRGQPRPEIQW-IKGTEPIEASEKFKPSDQADGYAKLVIVNPTEKDSGIYWCVAR 5961
            .::.:.|...|...|||..:| |.|.|..|....|:..::.:.: ||::........|.|.|...
  Fly  1613 GDSNVELVVGVDAYPRPHAKWYIDGIEIDEKRNDFRHVEEGNDF-KLIMNQVATNMQGNYTCKIM 1676

  Fly  5962 NEGAENKISHQVDFKGRQHYSLEKTHGFFHRDPNKPHFLLPLGNQTVCNGGTVAISAEFMETSTP 6026
            |:..:.:.:..|...                  .||.....|.|..|..|.:..:..| :.:...
  Fly  1677 NDYGKLEDNCVVTVN------------------CKPKVKRGLKNVEVQEGKSFTLEVE-VYSEPE 1722

  Fly  6027 IEVKWLRD-RRVVDGPNVKALADR---GVYTLTIMNAGPEVEGTYTCRASNAFGRIESNVNVDV- 6086
            .::||.:| ..:.:...:|...|.   ..|.||:..|..|..|||..:|:|..|...|...|.| 
  Fly  1723 AKIKWFKDGHEIYEDARIKISRDTQRIENYYLTLNLARTEDAGTYEMKATNFIGETTSTCKVAVL 1787

  Fly  6087 ---AVGAEKDERPPLFLSRPDTE----MKIAVGDPFS--------LSFRI--AGDPKPKLTFMKG 6134
               |:..|:.....|..:..:.|    .:|...|.|.        |.:.:  .|.|||:..:...
  Fly  1788 TSEALSLEQTVTKTLIATTEEPEEGAVPEIVHVDVFQQHSYESVPLKYEVIATGIPKPEAIWYHD 1852

  Fly  6135 TKDITQSDRVSKEVSDDYTRFSVQQAQISDSGTYFVVARNNFGTDRIFVTVTVNPRARSATP--T 6197
            .|.||.....:..|..|:.:..||...:.|:|.|.||.:|..|.......::::..|....|  |
  Fly  1853 GKPITPDKHTAITVDGDHYKLEVQSLDLVDAGEYKVVVQNKVGEKSHQGELSLSGIAEYRKPILT 1917

  Fly  6198 Q-PRWGLPLDSYSDTSYFRDPPGCISTEPLV--VDSGPTHISLSWGKP-VSANSAPVMAYKVEAW 6258
            | |  ||     .|....:....|   ||:|  .|..|..:.|..|:| |..|:..:...|.:| 
  Fly  1918 QGP--GL-----KDIKVNKGDKVC---EPVVFTADPAPEIVLLKDGQPVVETNNVKLKVDKKDA- 1971

  Fly  6259 VVGHEGGAYWRELGLT----PINSFDAFNLKPNVEYHFRVTPKNRYGWGPTVQTSSPLQVGGVEC 6319
                       |.||.    .:|..:| .:|.:..|..:|  ||:||   .:.||     |.::.
  Fly  1972 -----------ENGLVQYTCTLNILEA-EIKDSGRYELKV--KNKYG---ELVTS-----GWIDV 2014

  Fly  6320 L--PEFVKILPGQAKALLGSSFTLQCNMRGAPRPQVTWFKDGIQLSSSSERVKIRQI-GSTCALT 6381
            |  ||...:  ...|.|.|.:...:..::..|:|:|:|.:....|.:......|..: .....|.
  Fly  2015 LAKPEISGL--NDTKCLPGDTICFEALVQANPKPKVSWTRGNENLCNHENCEVIADVDADKYRLV 2077

  Fly  6382 IATVSELDSGRYTCEATNSKGRVSTFARLQVVSDSRIYEADSRLKEIAHGRNVADVGDSLPIFTM 6446
            ..:||..:.|:||..||||:||.:....|.|:.:.                         |.|.:
  Fly  2078 FQSVSPCEDGKYTITATNSEGRAAVDFNLAVLVEK-------------------------PTFIV 2117

  Fly  6447 RLRDRRVQVTYPVRLTCQIVGYPVPEILWYKDD-----ELIHTDRKHLISAEGQF--------FT 6498
            :...:.:....||.....:.|.|:|.|.|:|||     |.|:...|..:.|:...        ..
  Fly  2118 QPESQSIHDYRPVSTKVLVHGVPLPTIEWFKDDKPINYEAINKPGKDKLYAKEDTKKGTDQIESV 2182

  Fly  6499 LEIAATTLDDSGTYTCLARNELGSVSCHCTLVVDKGIRAYISPDFYVPLDPFYIFREGSEIRLST 6563
            |:|.:...:|.|.|||:|.||:|.......|.:     ..::|.|...||......:|..:.|..
  Fly  2183 LDIKSFRENDVGAYTCVATNEIGVTKAPFKLAM-----LSLAPSFVKKLDNALDVLQGEPLVLEC 2242

  Fly  6564 KVEAYPSVGVTWHRNGMRLRPSRRLTATLDSNGYVELIIAEATVRDAGIYVCVASNVVGKVETIC 6628
            .|:..|...|.|.::|..::||..:..:.:.:|.|:|.|......|:|.|..:.||..|:...:|
  Fly  2243 CVDGSPLPTVQWLKDGDEVKPSESIKISTNPDGLVKLEINSCQPNDSGAYKLIISNPHGEKVALC 2307

  Fly  6629 RVAVEEAENKAVAPQRSLEIPSIKTDDLPYSKEPLFVVKPRSSEAYEGDNVIIFCEVVGDPKPEV 6693
            .|||:                       |...:|.|:....|.....|:.:.:..:|.|.|.|||
  Fly  2308 AVAVK-----------------------PEEMQPKFLKPITSQTVVVGEPLKLEAQVTGFPAPEV 2349

  Fly  6694 VWLRDFL----NPEY-YKDAPHFRRIGDGPEYRLEIPSAKLDFTGTYSVIASNCHGEAKAVISLQ 6753
            .|.:|.:    :||. :.::|: .:||      |.|.:|:....|.|..:.:|..||.:.|..::
  Fly  2350 KWYKDGMLLRPSPEINFINSPN-GQIG------LIIDAAQPLDAGVYKCLIANKGGEIEGVSKVE 2407

  Fly  6754 IFAKDILNKSRMDKVHTRHGNIETLPRFVRNLRNLRCCDGDAISLECHVEADPEPFIIWEKDGHV 6818
            |..|                  |:.|.||..|::....:|..:.::..|..:|:|.:.|..:||.
  Fly  2408 IVPK------------------ESKPVFVAELQDASSIEGFPVKMDIKVVGNPKPKLQWFHNGHE 2454

  Fly  6819 MPSDRDYVMSFDG--TKATLSIPRVYPEDEGEYTCVAKNSVGRSLSSACIIVDVPEEKENMLSRQ 6881
            :..|..::...:.  ..::|.|.:..|.|.|.|..:|:|..|.:.|.|.:.|             
  Fly  2455 IKPDASHIAIVENPDNSSSLIIEKTAPGDSGLYEVIAQNPEGSTASKAKLYV------------- 2506

  Fly  6882 LARPSGLLSAHSTPRSTPRSTPARSFSPLRLSYRTSSIDLSGVAERRRSDARNAITAPKFLAIPY 6946
                        .|::...:|.                                 .||:|::...
  Fly  2507 ------------APKADETATE---------------------------------EAPQFVSALR 2526

  Fly  6947 NRVVEEGDSVRFQCAISGHPTPWATWDKDGLIVTPTPRIAVKEIDDLRI-IEIDEVTFDDAGLYR 7010
            :...:||..:........:|.|...|.|||:.:||..|: :...|...| :.|......|:|.|.
  Fly  2527 DVNADEGQELVLSAPFISNPMPEVIWSKDGVTLTPNERL-LMTCDGKHIGLTIKPAEAADSGNYT 2590

  Fly  7011 VTLENDFGRIEATARLDVIRSSRYSKSPSVRSVRASSSRRNAHLYRRIMGPSTAIGGRMALASGY 7075
            ..|.|..|...:....:|    |....|.|.:.:.|..::             ..|....:....
  Fly  2591 CLLANPLGEDSSACNANV----RKVYKPPVFTQKISDQQQ-------------VFGNNAKIPVTV 2638

  Fly  7076 RGSSVPSVRFYHNDVELEASERVHILLQDSMALLIVDNVTREDEGQYTCIISGDHDPLITSTTVT 7140
            .|...|.:.:|..|..:..||:..|.......:|||:|..:.|:|.|.||.|......||...: 
  Fly  2639 SGVPYPDLEWYFQDKPIPKSEKYSIKNDGDHHMLIVNNCEKGDQGVYKCIASNREGKDITQGRL- 2702

  Fly  7141 FHDSNTEIRRRRAVITERLPEITKSL------EGEVIDL-CCSIECDEPYSYVWLRNGEILPDSD 7198
              |...||::..   ....|...|.:      ||.|... .|:....|| ...|.:|.:.|..||
  Fly  2703 --DIVNEIKKHS---RSEPPVFLKKIGDCDIYEGMVAKFTACATGYPEP-EVEWFKNDQKLFPSD 2761

  Fly  7199 EFNYIDHGNGRLCLRINDAFDIDSGIYSCQVFTSDIND-STSDSTFDSHSICSLINSGCSDCSSS 7262
            .|......||.|.|.|.:..:.|.|.|||::|....:| ..::..:||                 
  Fly  2762 RFLIDIEPNGLLRLTIKNVTEYDVGRYSCRIFNPYGDDICHAELFYDS----------------- 2809

  Fly  7263 GELCVLERDLRGQDEECVQLLKT----PL---PVVCASGDEALFYARVFPCDAEADWYLNGQLLA 7320
              |...::.|..|..:..:..|:    ||   |::....|..|..:          |..:..|..
  Fly  2810 --LDSQQKPLEDQYTDFKKYKKSGAPPPLSEGPIISRMTDRGLLLS----------WNPSVPLTP 2862

  Fly  7321 QADDSLNMTLESYPENGIRLLRMRDVTASRSGEICLQVKHPQAEFR---RI----------PTTR 7372
            :...:..:.:...||...|.||    |..||....::...|..::|   |:          |.|:
  Fly  2863 RYPITYQIEMMDLPEGDWRTLR----TGVRSCACDIRNLEPFRDYRFRVRVENKFGVSDPSPYTQ 2923

  Fly  7373 TYTSLLV---------LPA---IRGNSS-------------SSSLAARSCILTRPEDCTALIGGH 7412
            ||...||         ||.   .|..:|             ...||.....|.|.:|.:..:..|
  Fly  2924 TYRQKLVPDPPKTYTYLPPGTDFRPETSPYFPKDFDIERPPHDGLAQAPQFLLREQDISYGVKDH 2988

  Fly  7413 VRLSVRYEPFPGTKVIWYKACHP-----------IVESSNVTIR--TTSQQSTLYITDISADDSG 7464
                       .|:::|:...:|           ::||.....:  |.:.|:||:|..:...|.|
  Fly  2989 -----------NTELMWFVYGYPKPKMTYYFDDMLIESGGRFDQSYTRNGQATLFINKMLDRDVG 3042

  Fly  7465 KYTVEVMNDYGVEAAAASVAVEGPPEP-----PSGQPSVSLGPDRVAVAWCGPPYDGGCMITGFI 7524
            .|.....|::|  .|...|.:|....|     |.....::....|:.....|.|          :
  Fly  3043 WYEAVATNEHG--EARQRVRLEIAEHPRFLKRPDETFIMARKNGRIEAKLVGIP----------L 3095

  Fly  7525 IEMQTIGDENCDEDSWQQVTRVVDSLAYTVKNLQPERQY------------RFRVRAENIHGRSA 7577
            .|:....|       |:.   :|||....:.:..|:...            .:.:.|.||.|   
  Fly  3096 PEVHWFKD-------WKP---IVDSSRIKISSYDPDIYVLSIHDSIIKDGGLYSISARNIAG--- 3147

  Fly  7578 PGQASELVQITNTPQRSTSSDASDRFGQATVSVQSGGD-------------------FKSRFEII 7623
                          ..|||         .||.::...|                   ::.:::|.
  Fly  3148 --------------SISTS---------VTVHIEENEDQYIYKTYGRHPYVRSKQLRYQDKYDIG 3189

  Fly  7624 EELGKGRFGIVYKVQERGQPEQLLAAKVIKCIKSQDRQKVLEEISIMRALQHPKLLQLAASFESP 7688
            :|||:|..||.|...||...:. .|||::.. :.:.|..:|.|:.:|....|..|::...::::.
  Fly  3190 DELGRGTQGITYHAVERSSGDN-YAAKIMYG-RPELRPFMLNELEMMNTFNHKNLIRPYDAYDTD 3252

  Fly  7689 REIVMVMEYITGGELF-ERVVADDFTLTEMDCILFLRQVCDGVAYMHGQSVVHLDLKPENIMCHT 7752
            |.:.::||...||||. :.::..|: .||.|...::||...|:.:||...|.|:.|..::::...
  Fly  3253 RSVTLIMELAAGGELVRDNLLRRDY-YTERDIAHYIRQTLWGLEHMHEMGVGHMGLTIKDLLISV 3316

  Fly  7753 RTSHQIKIIDFGLAQRLDTKAPVRVLFGTPEFIPPEIISYEPIGFQSDMWSVGVICYVLLSGLSP 7817
            .....||:.||||:::::......:.:|.|||:.||:::.|.:.|..|||:||:|.||||.|.:|
  Fly  3317 VGGDIIKVSDFGLSRKINRHNLSTLDYGMPEFVSPEVVNKEGVNFSHDMWTVGLITYVLLGGHNP 3381

  Fly  7818 FMGDTDVETFSNITRADYDYDDEAFDCVSQEAKDFISQLLVHRKEDRLTAQQCLASKW--LSQRP 7880
            |:|..|.||.:.|....:|:.||.:..:|.:.:||||:||::..|:|:..:..|...|  :..||
  Fly  3382 FLGIDDRETLTKIREGRWDFKDEIWTHISDDGRDFISRLLLYSPEERMDVKTALKHPWFFMLDRP 3446

  Fly  7881 --DDSLSNNKICTDKLKKFIIR-RKW 7903
              |   .:.:|.||:|:.:... |.|
  Fly  3447 VYD---HDYQIGTDRLRNYYDHFRDW 3469

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Strn-MlckNP_001261019.1 Ig_3 26..112 CDD:464046
Ig <70..112 CDD:472250
Ig strand E 92..96 CDD:409353
Ig strand F 106..111 CDD:409353
Ig 137..226 CDD:472250
Ig strand B 154..158 CDD:409353
Ig strand C 167..171 CDD:409353
Ig strand E 192..196 CDD:409353
Ig strand F 206..211 CDD:409353
Ig strand G 219..222 CDD:409353
Ig 235..314 CDD:472250
Ig strand B 251..255 CDD:409564
Ig strand C 264..268 CDD:409564
Ig strand E 280..284 CDD:409564
Ig strand F 294..299 CDD:409564
Ig strand G 307..310 CDD:409564
Ig_3 336..414 CDD:464046
Ig 438..513 CDD:472250
Ig strand B 454..458 CDD:409564
Ig strand C 467..471 CDD:409564
Ig strand E 483..487 CDD:409564
Ig strand F 493..498 CDD:409564
Ig strand G 506..509 CDD:409564
Ig 537..628 CDD:472250
Ig strand B 554..558 CDD:409353
Ig strand C 567..571 CDD:409353
Ig strand F 607..612 CDD:409353
Ig strand G 620..623 CDD:409353
Ig 636..713 CDD:472250
Ig strand B 652..656 CDD:409564
Ig strand C 665..669 CDD:409564
Ig strand E 681..685 CDD:409564
Ig strand F 695..700 CDD:409564
Ig strand G 708..711 CDD:409564
SMC_N <2131..2664 CDD:481474
PTZ00121 <2600..3256 CDD:173412
PTZ00121 <3635..4609 CDD:173412 82/454 (18%)
PTZ00121 <4215..5072 CDD:173412 173/941 (18%)
I-set 5300..5388 CDD:400151 20/92 (22%)
Ig strand B 5317..5321 CDD:409353 0/3 (0%)
Ig strand C 5329..5333 CDD:409353 1/3 (33%)
Ig strand E 5354..5358 CDD:409353 1/3 (33%)
Ig strand F 5368..5373 CDD:409353 1/4 (25%)
Ig_3 5399..5477 CDD:464046 19/79 (24%)
Ig 5542..5627 CDD:472250 18/86 (21%)
Ig strand B 5556..5560 CDD:409353 0/3 (0%)
Ig strand C 5568..5572 CDD:409353 0/3 (0%)
Ig strand E 5593..5597 CDD:409353 1/3 (33%)
Ig strand F 5607..5612 CDD:409353 2/4 (50%)
Ig 5654..5721 CDD:409353 20/69 (29%)
Ig strand B 5654..5658 CDD:409353 1/3 (33%)
Ig strand C 5665..5669 CDD:409353 1/3 (33%)
Ig strand E 5690..5694 CDD:409353 1/3 (33%)
Ig strand F 5704..5709 CDD:409353 0/4 (0%)
Ig strand G 5718..5721 CDD:409353 2/4 (50%)
I-set 5784..5874 CDD:400151 23/91 (25%)
Ig strand B 5801..5805 CDD:409353 0/3 (0%)
Ig strand C 5814..5818 CDD:409353 0/3 (0%)
Ig strand E 5840..5844 CDD:409353 2/4 (50%)
Ig strand F 5854..5859 CDD:409353 2/4 (50%)
Ig 5902..5963 CDD:409353 16/61 (26%)
Ig strand B 5902..5906 CDD:409353 1/3 (33%)
Ig strand C 5915..5919 CDD:409353 1/4 (25%)
Ig strand E 5941..5945 CDD:409353 2/3 (67%)
Ig strand F 5955..5960 CDD:409353 2/4 (50%)
Ig 5997..6086 CDD:472250 24/92 (26%)
Ig strand B 6014..6018 CDD:409353 0/3 (0%)
Ig strand C 6028..6032 CDD:409353 1/3 (33%)
Ig strand E 6050..6056 CDD:409353 2/5 (40%)
Ig strand F 6066..6071 CDD:409353 2/4 (50%)
Ig strand G 6079..6082 CDD:409353 1/2 (50%)
Ig 6107..6187 CDD:472250 22/89 (25%)
Ig strand B 6115..6119 CDD:409353 2/11 (18%)
Ig strand C 6128..6132 CDD:409353 0/3 (0%)
Ig strand E 6153..6157 CDD:409353 0/3 (0%)
Ig strand F 6167..6172 CDD:409353 2/4 (50%)
Ig strand G 6180..6183 CDD:409353 0/2 (0%)
FN3 6216..6310 CDD:238020 26/100 (26%)
I-set 6321..6412 CDD:400151 24/91 (26%)
Ig strand B 6339..6343 CDD:409353 0/3 (0%)
Ig strand C 6352..6356 CDD:409353 1/3 (33%)
Ig strand E 6375..6382 CDD:409353 1/6 (17%)
Ig strand F 6392..6397 CDD:409353 2/4 (50%)
Ig strand G 6405..6408 CDD:409353 0/2 (0%)
I-set 6442..6531 CDD:400151 28/101 (28%)
Ig strand B 6459..6463 CDD:409353 1/3 (33%)
Ig strand C 6472..6476 CDD:409353 1/3 (33%)
Ig strand E 6497..6501 CDD:409353 1/3 (33%)
Ig strand F 6511..6516 CDD:409353 3/4 (75%)
Ig strand G 6524..6527 CDD:409353 0/2 (0%)
Ig 6541..6632 CDD:472250 25/90 (28%)
Ig strand B 6559..6563 CDD:409353 1/3 (33%)
Ig strand C 6572..6576 CDD:409353 1/3 (33%)
Ig strand E 6598..6602 CDD:409353 2/3 (67%)
Ig strand F 6612..6617 CDD:409353 1/4 (25%)
Ig strand G 6625..6628 CDD:409353 0/2 (0%)
Ig 6662..6754 CDD:472250 26/96 (27%)
Ig strand B 6679..6683 CDD:409353 0/3 (0%)
Ig strand C 6692..6696 CDD:409353 2/3 (67%)
Ig strand E 6720..6724 CDD:409353 1/3 (33%)
Ig strand F 6734..6739 CDD:409353 1/4 (25%)
I-set 6779..6868 CDD:400151 23/90 (26%)
Ig strand B 6796..6800 CDD:409353 0/3 (0%)
Ig strand C 6809..6813 CDD:409353 0/3 (0%)
Ig strand E 6834..6838 CDD:409353 1/3 (33%)
Ig strand F 6848..6853 CDD:409353 1/4 (25%)
I-set 6939..7028 CDD:400151 22/89 (25%)
Ig strand B 6956..6960 CDD:409353 0/3 (0%)
Ig strand C 6969..6973 CDD:409353 0/3 (0%)
Ig strand E 6993..6998 CDD:409353 1/5 (20%)
Ig strand F 7008..7013 CDD:409353 1/4 (25%)
Ig strand G 7021..7024 CDD:409353 0/2 (0%)
IG_like 7075..7140 CDD:214653 19/64 (30%)
Ig strand C 7082..7086 CDD:409353 0/3 (0%)
Ig strand E 7107..7111 CDD:409353 1/3 (33%)
Ig strand F 7121..7126 CDD:409353 2/4 (50%)
Ig strand G 7135..7138 CDD:409353 1/2 (50%)
Ig 7173..7232 CDD:409353 20/59 (34%)
Ig strand C 7184..7188 CDD:409353 0/3 (0%)
Ig strand E 7210..7214 CDD:409353 2/3 (67%)
Ig strand F 7224..7229 CDD:409353 3/4 (75%)
IG_like 7406..7475 CDD:214653 15/81 (19%)
Ig strand B 7413..7417 CDD:409353 0/3 (0%)
Ig strand C 7426..7430 CDD:409353 0/3 (0%)
Ig strand E 7451..7455 CDD:409353 2/3 (67%)
Ig strand F 7465..7470 CDD:409353 1/4 (25%)
FN3 7489..7588 CDD:238020 16/115 (14%)
STKc_MLCK 7626..7876 CDD:271005 82/252 (33%)
ObscNP_001097440.1 RhoGEF 90..260 CDD:238091 29/179 (16%)
PH_unc89 275..388 CDD:270134 20/112 (18%)
Not5 <477..>652 CDD:444384 49/250 (20%)
Ig 1017..1108 CDD:472250 28/137 (20%)
Ig strand B 1034..1038 CDD:409353 1/12 (8%)
Ig strand C 1046..1050 CDD:409353 2/9 (22%)
Ig strand E 1074..1078 CDD:409353 1/3 (33%)
Ig strand F 1088..1093 CDD:409353 1/4 (25%)
Ig strand G 1101..1104 CDD:409353 0/2 (0%)
I-set 1123..1212 CDD:400151 21/95 (22%)
Ig strand B 1140..1144 CDD:409353 0/3 (0%)
Ig strand C 1153..1157 CDD:409353 0/3 (0%)
Ig strand E 1182..1186 CDD:409353 1/3 (33%)
Ig strand F 1196..1201 CDD:409353 2/4 (50%)
Ig strand G 1209..1212 CDD:409353 0/9 (0%)
Ig <1236..1299 CDD:472250 16/73 (22%)
Ig strand C 1238..1242 CDD:409353 0/14 (0%)
Ig strand E 1259..1269 CDD:409353 1/9 (11%)
Ig strand F 1279..1284 CDD:409353 2/4 (50%)
Ig strand G 1292..1295 CDD:409353 0/2 (0%)
I-set 1313..1403 CDD:400151 23/99 (23%)
Ig strand B 1330..1334 CDD:409353 2/13 (15%)
Ig strand C 1343..1347 CDD:409353 1/3 (33%)
Ig strand E 1369..1373 CDD:409353 1/3 (33%)
Ig strand F 1383..1388 CDD:409353 0/4 (0%)
Ig strand G 1396..1399 CDD:409353 0/2 (0%)
Ig_3 1406..1487 CDD:464046 12/92 (13%)
I-set 1499..1595 CDD:400151 25/96 (26%)
Ig strand B 1522..1526 CDD:409353 0/3 (0%)
Ig strand C 1535..1539 CDD:409353 0/3 (0%)
Ig strand E 1561..1565 CDD:409353 1/3 (33%)
Ig strand F 1575..1580 CDD:409353 2/4 (50%)
Ig strand G 1588..1591 CDD:409353 0/2 (0%)
Ig 1599..1690 CDD:472250 22/94 (23%)
Ig strand B 1617..1621 CDD:409353 1/3 (33%)
Ig strand C 1630..1634 CDD:409353 0/3 (0%)
Ig strand E 1656..1660 CDD:409353 2/4 (50%)
Ig strand F 1670..1675 CDD:409353 2/4 (50%)
Ig strand G 1683..1686 CDD:409353 0/2 (0%)
I-set 1694..1786 CDD:400151 24/92 (26%)
Ig strand B 1711..1715 CDD:409353 0/3 (0%)
Ig strand C 1724..1728 CDD:409353 1/3 (33%)
Ig strand E 1752..1756 CDD:409353 2/3 (67%)
Ig strand F 1766..1771 CDD:409353 2/4 (50%)
Ig strand G 1779..1782 CDD:409353 1/2 (50%)
Ig <1836..1903 CDD:472250 18/66 (27%)
Ig strand C 1846..1850 CDD:409353 0/3 (0%)
Ig strand E 1871..1875 CDD:409353 0/3 (0%)
Ig strand F 1885..1890 CDD:409353 2/4 (50%)
Ig 1922..2005 CDD:472250 27/108 (25%)
Ig strand B 1933..1937 CDD:409353 2/6 (33%)
Ig strand C 1946..1950 CDD:409353 0/3 (0%)
Ig strand E 1971..1984 CDD:409353 4/24 (17%)
Ig strand F 1994..1999 CDD:409353 1/4 (25%)
Ig 2018..2108 CDD:472250 24/91 (26%)
Ig strand B 2034..2038 CDD:409353 0/3 (0%)
Ig strand C 2047..2051 CDD:409353 1/3 (33%)
Ig strand E 2074..2078 CDD:409353 1/3 (33%)
Ig strand F 2088..2093 CDD:409353 2/4 (50%)
Ig strand G 2101..2104 CDD:409353 0/2 (0%)
Ig 2113..2214 CDD:472250 27/100 (27%)
Ig strand B 2130..2134 CDD:409353 1/3 (33%)
Ig strand C 2143..2147 CDD:409353 1/3 (33%)
Ig strand E 2176..2185 CDD:409353 1/8 (13%)
Ig strand F 2195..2200 CDD:409353 3/4 (75%)
I-set 2220..2302 CDD:400151 22/81 (27%)
Ig strand B 2238..2242 CDD:409353 1/3 (33%)
Ig strand C 2251..2255 CDD:409353 1/3 (33%)
Ig strand E 2277..2281 CDD:409353 2/3 (67%)
Ig strand F 2291..2296 CDD:409353 1/4 (25%)
Ig strand G 2304..2307 CDD:409353 0/2 (0%)
I-set 2318..2408 CDD:400151 26/96 (27%)
Ig strand B 2335..2339 CDD:409353 0/3 (0%)
Ig strand C 2348..2352 CDD:409353 2/3 (67%)
Ig strand E 2374..2378 CDD:409353 3/9 (33%)
Ig strand F 2388..2393 CDD:409353 1/4 (25%)
Ig 2415..2506 CDD:472250 23/90 (26%)
Ig strand B 2432..2436 CDD:409353 0/3 (0%)
Ig strand C 2445..2449 CDD:409353 0/3 (0%)
Ig strand E 2472..2476 CDD:409353 1/3 (33%)
Ig strand F 2486..2491 CDD:409353 1/4 (25%)
Ig strand G 2499..2502 CDD:409353 1/2 (50%)
I-set 2519..2608 CDD:400151 22/89 (25%)
Ig strand B 2536..2540 CDD:409353 0/3 (0%)
Ig strand C 2549..2553 CDD:409353 0/3 (0%)
Ig strand E 2574..2578 CDD:409353 1/3 (33%)
Ig strand F 2588..2593 CDD:409353 1/4 (25%)
I-set 2615..2696 CDD:400151 20/93 (22%)
Ig strand B 2632..2636 CDD:409353 0/3 (0%)
Ig strand C 2645..2649 CDD:409353 0/3 (0%)
Ig strand E 2670..2674 CDD:409353 1/3 (33%)
Ig strand F 2684..2689 CDD:409353 2/4 (50%)
Ig strand G 2697..2700 CDD:409353 2/2 (100%)
I-set 2717..2805 CDD:400151 26/88 (30%)
Ig strand B 2734..2738 CDD:409353 0/3 (0%)
Ig strand C 2747..2751 CDD:409353 0/3 (0%)
Ig strand E 2773..2777 CDD:409353 2/3 (67%)
Ig strand F 2787..2792 CDD:409353 3/4 (75%)
Ig strand G 2800..2803 CDD:409353 0/2 (0%)
FN3 2834..2925 CDD:238020 20/104 (19%)
Ig <2996..3063 CDD:472250 15/68 (22%)
Ig strand C 3003..3007 CDD:409353 0/3 (0%)
Ig strand E 3029..3033 CDD:409353 2/3 (67%)
Ig strand F 3043..3048 CDD:409353 1/4 (25%)
Ig strand G 3056..3059 CDD:409353 0/2 (0%)
Ig 3067..3157 CDD:472250 21/135 (16%)
Ig strand B 3085..3088 CDD:409353 1/2 (50%)
Ig strand C 3097..3101 CDD:409353 1/3 (33%)
Ig strand E 3123..3127 CDD:409353 0/3 (0%)
Ig strand F 3137..3142 CDD:409353 0/4 (0%)
Ig strand G 3150..3153 CDD:409353 3/11 (27%)
PK_Unc-89_rpt1 3182..3440 CDD:271011 83/260 (32%)
Ig 3654..3744 CDD:472250
Ig strand B 3671..3675 CDD:409353
Ig strand C 3684..3688 CDD:409353
Ig strand E 3710..3714 CDD:409353
Ig strand F 3724..3729 CDD:409353
Ig strand G 3737..3740 CDD:409353
FN3 3748..3840 CDD:238020
STKc_Unc-89_rpt2 3893..4151 CDD:271014
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.