DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Strn-Mlck and hmcn2

DIOPT Version :10

Sequence 1:NP_001261019.1 Gene:Strn-Mlck / 36753 FlyBaseID:FBgn0265045 Length:8255 Species:Drosophila melanogaster
Sequence 2:XP_031747766.1 Gene:hmcn2 / 100490941 XenbaseID:XB-GENE-6034990 Length:4625 Species:Xenopus tropicalis


Alignment Length:2356 Identity:551/2356 - (23%)
Similarity:879/2356 - (37%) Gaps:537/2356 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly  5311 TASGSD-LKLTCGLSGHEM-NVQWFKDNCPI--ENGAKYRRTLNDGLSCLEIKSAELGDSGIYRC 5371
            |.:.:| |.|:|..:|:.. .:||.::|..:  |:|.:   .||.| ..|.|:..:...:|.|:|
 Frog  1719 TVTANDPLDLSCHATGYPTPTIQWLRNNHSLSHEDGVE---VLNGG-KMLTIRQIQPEHAGKYKC 1779

  Fly  5372 IASNQNGEVETSCLVTIYEAPSSKF--GTPPI--FTRNIRDAYHSQGNQLTLECKVSGSPKPHIY 5432
            .|...:|..|....|.:.|.||...  ||..:  |.:.:           .|||.|||||.|.:.
 Frog  1780 KAEGDSGTAEAWVEVEVQELPSVTIAGGTTMVVNFLKRV-----------VLECDVSGSPPPSVT 1833

  Fly  5433 WQRDNTLLPIEGTKYQYEEQSDGIKLLTINNFGSNDSGLYTCYAESENGQ--------MKISKFV 5489
            |.:|..|||::|.|.|            |::...:|.|:|||.|.:..|:        :.:|..:
 Frog  1834 WWKDGFLLPVQGPKLQ------------IDSVSIDDEGVYTCVATNFAGEGRQDVVLTVLVSPNI 1886

  Fly  5490 QASDYVRERIADKKPIDKVIQEIKRDESSSAAANDTAAAKAKAREAKLRLNLETSLKTMTIGSGN 5554
            :.||           :::.:.|                            ||..|.:.:..||. 
 Frog  1887 EPSD-----------VNQTVIE----------------------------NLPASFECLASGSP- 1911

  Fly  5555 KAQLICYVTGIIEDVHWLRNDERVTKDARHKIYNINGAISLEIYDARVEDSGHYRCVVKNSRQTV 5619
                       :..|.|.|.::.::  |...|..:|...:|:|..|:..|||.||||..|:..:.
 Frog  1912 -----------LPLVSWYRGEQLLS--AAPGITLLNEGKTLQIESAKSSDSGEYRCVASNTAGST 1963

  Fly  5620 ESAGQL---------SVLDQSTGKLPESFSSGIIESYDDQRNEIVLSCQVIG--RPSVSWMRDDH 5673
            |....|         |::|.:|..:.|               ::.|.|...|  .|::.|::|..
 Frog  1964 ELQYNLLVNVAPRIVSMMDFATFLVNE---------------QVWLECNATGVPEPAIMWLKDQV 2013

  Fly  5674 SICNN-RYRTIEEPGGVRKLVIRNPISSDCGIFACYAEHEDRIDSTSI--------TIKAADLKR 5729
            .:... ....|.|.|  |.|.:|....||.||::|.|.:....||..|        ||...:|..
 Frog  2014 PVSTAIAGLQIMEQG--RILSLRAAHVSDSGIYSCVAVNPAGEDSHHIALQVFVPPTIMGEELNS 2076

  Fly  5730 LINVSQEEIPSIGDHEST-------PWSRSQSHL--SSGSQVNGNGELHRAGDRVLRNVGK---- 5781
            .|.|:|   |.:.:.:||       .|.:....|  ..|.||..:|...:.....||:.|:    
 Frog  2077 SIAVNQ---PLLLECQSTAIPPPLITWLKDGRPLLQRPGVQVIDDGHYLQIDQAQLRDAGRYTCE 2138

  Fly  5782 -----GK------------PLF-------HTLLHDRTVSEGANLRLVCSVSGDENTHIEWLKNHK 5822
                 |:            |.|       |:::      ||..:...|..:|.....:.|.||..
 Frog  2139 ASNDAGRTEKHYNVIIWVPPSFPEPSAPHHSII------EGQPVSFTCECTGVPPPTLTWTKNGL 2197

  Fly  5823 PLPRSDNRYQTVYLNGEASLEIFAAVADDSGNYTCCATNDFGESLTHAQLRVYKNFKEAPLPSTF 5887
            ||...|:...:.   |...|:|......|.|:|.|..:|..|.:.....|.||.....|...:|.
 Frog  2198 PLTVEDSGLVSA---GGRLLQIGKVQLSDEGSYICECSNQAGSNKKEYWLEVYAQPMIAGSSNTP 2259

  Fly  5888 TQPIRDTYSLNENELV-LDCRVRGQPRPEIQWIKGTEPIEASEK--FKPSDQADGYAKLVIVNPT 5949
            .|     ..:|:..|| ::|.|.|:|.|.:.|:|...|:.....  |:...|     :|.|:...
 Frog  2260 KQ-----LMVNKGSLVTMECVVSGKPSPSVTWLKDGYPLGNGPDLFFQNKGQ-----QLTILKAQ 2314

  Fly  5950 EKDSGIYWCVARNEGAENKISHQVDFKGRQHYSLEKTHGFFHRDPNKPHFLLPLGNQTVCNGGTV 6014
            ...||.|.|||.|...:..|.::|               |....|..|:....|.|.:....||.
 Frog  2315 PSHSGRYVCVAVNAAGQTDIKYEV---------------FVQVPPELPNTQTELLNVSTSLHGTF 2364

  Fly  6015 AISAEFMETSTPIEVKWLRDRRVVDGPNVKALADRGVYTLTIMNAGPEVEGTYTCRASNAFGRIE 6079
            .|:.|......|: :.|.|:...: .|........|...|.|.:|..:..|.|||..:|..|:.:
 Frog  2365 TITCEATGIPPPV-ITWFRNNEAL-SPRENVHLQSGGRVLRITHAQIQDAGHYTCVVTNTAGQAK 2427

  Fly  6080 SNVNVDVAVGAEKDERPPLFLSRPDTEMKIAVGDPFSLSFRIAGDPKPKLTFMKGTKDITQSDRV 6144
            .:..||:.|       ||......|.::::..|...:||.:::|.|||.:|:::.::.:...|.|
 Frog  2428 KDFFVDILV-------PPSIDGEDDNDLRVPEGQSVTLSCKVSGHPKPLITWLRDSQPVQSGDEV 2485

  Fly  6145 SKEVSDDYTRFSVQQAQISDSGTYFVVARNNFG--TDRIFVTVTVNPRARSATPTQPRWGLPLDS 6207
            .  :|.|.:...:|.|.:.:.|.|..:|.|:..  :....|||.|:|....          |||.
 Frog  2486 L--ISPDGSELHIQSANVFNVGHYTCIAINSIAERSRSYIVTVLVSPTISG----------PLDD 2538

  Fly  6208 YSDTSYFRDPPGCISTEPLVVDSGPTHI----------SLSW---GKPVSANSAPVMAYKVEAWV 6259
            .:            :.:.:|:.:.|..:          |::|   |:|...:.      .:....
 Frog  2539 EA------------NEDVIVIVNNPFSLICEALGFPIPSVTWLKNGEPFKDSD------NLRLLP 2585

  Fly  6260 VGHEGGAYWRELGLTPINSFDAFNLKPNVEYHFRVTPKNRYGWG-----------PTVQTSSPLQ 6313
            .||         ||..:|:.:    :.:.:|...||  |..|..           |.::...|.|
 Frog  2586 GGH---------GLQILNAQE----EDSGQYTCVVT--NEVGEAIRNYEVKVFIPPVIKRDDPHQ 2635

  Fly  6314 VGGVECLPEFVKILPGQAKALLGSSFTLQCNMRGAPRPQVTWFKDGIQLSSSSERVKIRQIGSTC 6378
            ..|::           :.|..:.||.||||..:..|:|.:.|:||| ||..||..|:|...|...
 Frog  2636 DVGIK-----------EVKTKVNSSLTLQCESQAVPKPTLHWYKDG-QLLESSGGVQILSDGQEL 2688

  Fly  6379 ALTIATVSELDSGRYTCEATNSKGRVSTFARLQVVSDSRIYEADSRLKEIAHGRNVADVGDSLPI 6443
            .|....:|  |||||||.|||..|           .|.:.:..:.::..|.|     ..|.....
 Frog  2689 QLQPIRLS--DSGRYTCVATNVAG-----------EDEKEFYVNVQVPPIFH-----RPGSPSAA 2735

  Fly  6444 FTMRLRD---------RRVQVTYPVRLTCQIVGYPVPEILWYKDDELIHTDRKHLISAEGQFFTL 6499
            |.:..||         |.|..|.|:.|.|.....|.|.:.||||.:|:.:....||..||:.  |
 Frog  2736 FELVPRDDDEEELTEHREVVATNPISLYCDTNAIPPPILTWYKDGQLLSSSDGVLILLEGRI--L 2798

  Fly  6500 EIAATTLDDSGTYTCLARNELGSVSCHCTLVVDKGIRAYISPDFYVPL----------DPFYIFR 6554
            :|.......:|.|||.|.||.|....|..|||       ::|    |:          :...|:.
 Frog  2799 QIPMAHAKHAGKYTCEATNEAGEDRLHYELVV-------LTP----PVMKGEVDELIQEVSVIYN 2852

  Fly  6555 EGSEIRLSTKVEAYPSVGVTWHRNGMRLRPSRRLTATLDSNGYVELIIAEATVRDAGIYVCVASN 6619
            :.:|  |.......|...:||.|||:.|..:.|....   |....|.|....|.|...|||||.|
 Frog  2853 QTAE--LHCDASGIPPPSITWLRNGLTLSTAERYQIL---NEGKTLQIHSVQVSDIDSYVCVAEN 2912

  Fly  6620 VVGKVETICRVAVEEAENKAVAPQRSLEIPSIKTDDLPYSKEPLFVVKPRSSEAYEGDNVIIFCE 6684
            ..|..|.:..:.|...                     |....|    .|.:..|....:|.:.|:
 Frog  2913 PAGFAERLFTLMVHVT---------------------PVISGP----NPENISAVLQSSVSLVCD 2952

  Fly  6685 VVGDPKPEVVWLRD--FLNPEYYKDAPHFRRIGDGPEYRLEIPSAKLDFTGTYSVIASNCHGEAK 6747
            |...|.||::|.:|  .|.|      .....|..|.:. |:|...::...|.|.....|..|.|:
 Frog  2953 VQSHPTPEIMWYKDGQLLTP------TKGLLIMPGGQV-LQIARVQMSNQGIYMCKVHNPAGSAE 3010

  Fly  6748 AVISLQIFAKDILNKSRMDKVHTRHGNIETLPRFVRNLRNLRCCDGDAISLECHVEADPEPFIIW 6812
            .::.|.::....:.:       ..:|..||:.|.           ||:::|:|..:|.|.|.|.|
 Frog  3011 KLLHLIVYVPPSIKE-------PPNGKQETVVRL-----------GDSLTLQCESDALPRPTITW 3057

  Fly  6813 EKDGHVMPSDRDYVMSFDGTKATLSIPRVYPEDEGEYTCVAKNSVGRSLSSACIIVDVPE---EK 6874
            .|:||.:..:.  |:........|.|..:...|:|:|||...|..|....:..:|::||.   ..
 Frog  3058 YKNGHQLLENG--VVRIHDHGQRLEILDIKASDKGQYTCKVANMAGEVELTYTVIINVPATIVRP 3120

  Fly  6875 ENMLSRQLARPSGLLSAHSTPRSTPRSTPARSFSPL-----RLSYRTSSIDLSGV----AERRRS 6930
            :|...:.:...|.:||..:....:|..|..:...||     .::.|.|.:.::.|    |.|.|.
 Frog  3121 QNETIQLIIGNSIVLSCEAEGSPSPVVTWLKDGEPLDSGVWGVAIRGSRLQITRVQQSHAGRYRC 3185

  Fly  6931 DARNAIT------------APKFLA--IPYNRVVEEGDSVRFQCAISGHPTPWATWDKDG--LIV 6979
            .|:|:|:            ||:...  :|....|.|...|:.:|...|.|.|...|.|||  |.|
 Frog  3186 IAQNSISETHKDFVLLVQVAPRIFGSEMPSEHSVPEKQEVKLECKTEGTPAPQILWFKDGNPLDV 3250

  Fly  6980 TPTPRIAVKEIDDLRIIEIDEVTFDDAGLYRVTLENDFGRIEATARLDVIRSSRYSKSPSVRSVR 7044
            |..|...|  ..|...:.:..|...|:|.|.....|:.|.......|:::          |..:.
 Frog  3251 TLVPNTRV--FQDGNFLVLRSVQASDSGRYTCVARNNAGEDTRVYVLNIL----------VPPIF 3303

  Fly  7045 ASSSRRNAHLYRRIMGPSTAIGGRMALASGYRGSSVPSVRFYHNDVELEASERVHILLQDSMALL 7109
            .|.|..:..|       |:..||::.|.....||....:.::.:...|..|..|.|  .....:|
 Frog  3304 ESGSNASDVL-------SSVPGGQVTLECHASGSLPLKLSWFKDGHPLSTSRYVRI--ASGGRIL 3359

  Fly  7110 IVDNVTREDEGQYTCIISGDHDPLITSTTVTFHDSNTEIRRRRAVITERLPEITKSLEGEVIDLC 7174
            ....|...|.|.|||:.|....  ........|..:..:..|    :|...|:| :::|..:...
 Frog  3360 RFSQVQVSDAGTYTCVASSPAG--AAEKNFVLHIESLPVLER----SESTEEVT-AIKGASVTFT 3417

  Fly  7175 CSIECDEPYSYVWLRNGEILPDSDEFNYIDHGNGRLCLRINDAFDIDSGIYSCQVFTSDINDSTS 7239
            |........|..|.::|:  |.:.:.|.:.:|.|.. |.:.....:|||||||            
 Frog  3418 CEAHGTPLPSLSWEKDGQ--PLNLQSNLLPNGLGTR-LHLESVRALDSGIYSC------------ 3467

  Fly  7240 DSTFDSHSICSLINSGCSDCSSSGELCVLERD-LRGQ--DEECVQLLKTPLPVVC-ASGDEALFY 7300
                       :..:.....|....|.|||.. :.|.  ..|...:..:||.:.| |:|...   
 Frog  3468 -----------IAVNAAGRVSKHFHLTVLEPPRIEGPALPTEVSIIADSPLELACTATGVPT--- 3518

  Fly  7301 ARVFPCDAEADWYLNGQLLAQADDSLNMTLESYPENGIRLLRMRDVTASRSG-EICLQVKHPQAE 7364
                   .|..|..:|:.|:..|        ....|| .:||:..|.|..:| .:|:.......:
 Frog  3519 -------PEISWEKDGRPLSHPD--------LLTRNG-TVLRIERVKAEDAGIYVCVATSTAGRD 3567

  Fly  7365 FRRIPTTRTYTSLLVLPAIRGNSSSSSLAARSCILTRPEDCTALIGGHVRLSVRYEPFPGTKVIW 7429
            .|     .|:..:.|.|::.|::...|||..             :||.:.|..:.|..|...:.|
 Frog  3568 SR-----ATWVRMKVPPSVVGSTEPRSLAVS-------------VGGQLVLECKVEADPPPTIQW 3614

  Fly  7430 YKACHPIVESSNVTIRTTSQQSTLYITDISADDSGKYTVEVMNDYGVEAAAASVAVEGPPEPPSG 7494
            |:...|:.....|.:  .|:...:.|..:...|||:||....|..|..:...:|.::..|....|
 Frog  3615 YRGDIPLQTDGRVQV--LSKGRYVQIHSLRPSDSGEYTCIASNPAGRTSLHFTVEIQLAPMIQPG 3677

  Fly  7495 QPSVSLGPDRVAVAWC 7510
            ...||:..::.||..|
 Frog  3678 PSVVSVSVNQTAVLPC 3693

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Strn-MlckNP_001261019.1 Ig_3 26..112 CDD:464046
Ig <70..112 CDD:472250
Ig strand E 92..96 CDD:409353
Ig strand F 106..111 CDD:409353
Ig 137..226 CDD:472250
Ig strand B 154..158 CDD:409353
Ig strand C 167..171 CDD:409353
Ig strand E 192..196 CDD:409353
Ig strand F 206..211 CDD:409353
Ig strand G 219..222 CDD:409353
Ig 235..314 CDD:472250
Ig strand B 251..255 CDD:409564
Ig strand C 264..268 CDD:409564
Ig strand E 280..284 CDD:409564
Ig strand F 294..299 CDD:409564
Ig strand G 307..310 CDD:409564
Ig_3 336..414 CDD:464046
Ig 438..513 CDD:472250
Ig strand B 454..458 CDD:409564
Ig strand C 467..471 CDD:409564
Ig strand E 483..487 CDD:409564
Ig strand F 493..498 CDD:409564
Ig strand G 506..509 CDD:409564
Ig 537..628 CDD:472250
Ig strand B 554..558 CDD:409353
Ig strand C 567..571 CDD:409353
Ig strand F 607..612 CDD:409353
Ig strand G 620..623 CDD:409353
Ig 636..713 CDD:472250
Ig strand B 652..656 CDD:409564
Ig strand C 665..669 CDD:409564
Ig strand E 681..685 CDD:409564
Ig strand F 695..700 CDD:409564
Ig strand G 708..711 CDD:409564
SMC_N <2131..2664 CDD:481474
PTZ00121 <2600..3256 CDD:173412
PTZ00121 <3635..4609 CDD:173412
PTZ00121 <4215..5072 CDD:173412
I-set 5300..5388 CDD:400151 23/80 (29%)
Ig strand B 5317..5321 CDD:409353 2/3 (67%)
Ig strand C 5329..5333 CDD:409353 1/3 (33%)
Ig strand E 5354..5358 CDD:409353 1/3 (33%)
Ig strand F 5368..5373 CDD:409353 2/4 (50%)
Ig_3 5399..5477 CDD:464046 24/79 (30%)
Ig 5542..5627 CDD:472250 22/93 (24%)
Ig strand B 5556..5560 CDD:409353 0/3 (0%)
Ig strand C 5568..5572 CDD:409353 1/3 (33%)
Ig strand E 5593..5597 CDD:409353 1/3 (33%)
Ig strand F 5607..5612 CDD:409353 3/4 (75%)
Ig 5654..5721 CDD:409353 21/77 (27%)
Ig strand B 5654..5658 CDD:409353 1/3 (33%)
Ig strand C 5665..5669 CDD:409353 0/3 (0%)
Ig strand E 5690..5694 CDD:409353 2/3 (67%)
Ig strand F 5704..5709 CDD:409353 2/4 (50%)
Ig strand G 5718..5721 CDD:409353 1/10 (10%)
I-set 5784..5874 CDD:400151 23/96 (24%)
Ig strand B 5801..5805 CDD:409353 0/3 (0%)
Ig strand C 5814..5818 CDD:409353 0/3 (0%)
Ig strand E 5840..5844 CDD:409353 1/3 (33%)
Ig strand F 5854..5859 CDD:409353 2/4 (50%)
Ig 5902..5963 CDD:409353 20/63 (32%)
Ig strand B 5902..5906 CDD:409353 2/4 (50%)
Ig strand C 5915..5919 CDD:409353 0/3 (0%)
Ig strand E 5941..5945 CDD:409353 1/3 (33%)
Ig strand F 5955..5960 CDD:409353 2/4 (50%)
Ig 5997..6086 CDD:472250 22/88 (25%)
Ig strand B 6014..6018 CDD:409353 1/3 (33%)
Ig strand C 6028..6032 CDD:409353 0/3 (0%)
Ig strand E 6050..6056 CDD:409353 2/5 (40%)
Ig strand F 6066..6071 CDD:409353 3/4 (75%)
Ig strand G 6079..6082 CDD:409353 0/2 (0%)
Ig 6107..6187 CDD:472250 21/81 (26%)
Ig strand B 6115..6119 CDD:409353 1/3 (33%)
Ig strand C 6128..6132 CDD:409353 1/3 (33%)
Ig strand E 6153..6157 CDD:409353 0/3 (0%)
Ig strand F 6167..6172 CDD:409353 1/4 (25%)
Ig strand G 6180..6183 CDD:409353 0/2 (0%)
FN3 6216..6310 CDD:238020 17/117 (15%)
I-set 6321..6412 CDD:400151 33/90 (37%)
Ig strand B 6339..6343 CDD:409353 2/3 (67%)
Ig strand C 6352..6356 CDD:409353 0/3 (0%)
Ig strand E 6375..6382 CDD:409353 2/6 (33%)
Ig strand F 6392..6397 CDD:409353 4/4 (100%)
Ig strand G 6405..6408 CDD:409353 0/2 (0%)
I-set 6442..6531 CDD:400151 32/97 (33%)
Ig strand B 6459..6463 CDD:409353 1/3 (33%)
Ig strand C 6472..6476 CDD:409353 0/3 (0%)
Ig strand E 6497..6501 CDD:409353 1/3 (33%)
Ig strand F 6511..6516 CDD:409353 3/4 (75%)
Ig strand G 6524..6527 CDD:409353 0/2 (0%)
Ig 6541..6632 CDD:472250 26/100 (26%)
Ig strand B 6559..6563 CDD:409353 1/3 (33%)
Ig strand C 6572..6576 CDD:409353 1/3 (33%)
Ig strand E 6598..6602 CDD:409353 1/3 (33%)
Ig strand F 6612..6617 CDD:409353 3/4 (75%)
Ig strand G 6625..6628 CDD:409353 1/2 (50%)
Ig 6662..6754 CDD:472250 23/93 (25%)
Ig strand B 6679..6683 CDD:409353 1/3 (33%)
Ig strand C 6692..6696 CDD:409353 1/3 (33%)
Ig strand E 6720..6724 CDD:409353 1/3 (33%)
Ig strand F 6734..6739 CDD:409353 1/4 (25%)
I-set 6779..6868 CDD:400151 23/88 (26%)
Ig strand B 6796..6800 CDD:409353 1/3 (33%)
Ig strand C 6809..6813 CDD:409353 1/3 (33%)
Ig strand E 6834..6838 CDD:409353 1/3 (33%)
Ig strand F 6848..6853 CDD:409353 3/4 (75%)
I-set 6939..7028 CDD:400151 26/92 (28%)
Ig strand B 6956..6960 CDD:409353 1/3 (33%)
Ig strand C 6969..6973 CDD:409353 0/3 (0%)
Ig strand E 6993..6998 CDD:409353 0/4 (0%)
Ig strand F 7008..7013 CDD:409353 1/4 (25%)
Ig strand G 7021..7024 CDD:409353 0/2 (0%)
IG_like 7075..7140 CDD:214653 14/64 (22%)
Ig strand C 7082..7086 CDD:409353 0/3 (0%)
Ig strand E 7107..7111 CDD:409353 1/3 (33%)
Ig strand F 7121..7126 CDD:409353 3/4 (75%)
Ig strand G 7135..7138 CDD:409353 0/2 (0%)
Ig 7173..7232 CDD:409353 16/58 (28%)
Ig strand C 7184..7188 CDD:409353 1/3 (33%)
Ig strand E 7210..7214 CDD:409353 1/3 (33%)
Ig strand F 7224..7229 CDD:409353 4/4 (100%)
IG_like 7406..7475 CDD:214653 17/68 (25%)
Ig strand B 7413..7417 CDD:409353 1/3 (33%)
Ig strand C 7426..7430 CDD:409353 0/3 (0%)
Ig strand E 7451..7455 CDD:409353 0/3 (0%)
Ig strand F 7465..7470 CDD:409353 2/4 (50%)
FN3 7489..7588 CDD:238020 7/22 (32%)
STKc_MLCK 7626..7876 CDD:271005
hmcn2XP_031747766.1 vWFA 29..165 CDD:238119
IG_like 434..503 CDD:214653
Ig strand B 434..438 CDD:409353
Ig strand C 447..451 CDD:409353
Ig strand E 469..473 CDD:409353
Ig strand F 483..488 CDD:409353
Ig 514..592 CDD:472250
Ig strand B 524..528 CDD:409353
Ig strand C 537..541 CDD:409353
Ig strand E 558..562 CDD:409353
Ig strand F 572..577 CDD:409353
Ig strand G 585..588 CDD:409353
I-set 596..681 CDD:400151
Ig strand B 613..617 CDD:409353
Ig strand C 626..630 CDD:409353
Ig strand E 648..652 CDD:409353
Ig strand F 662..667 CDD:409353
Ig strand G 676..679 CDD:409353
Ig 695..770 CDD:472250
Ig strand B 703..707 CDD:409353
Ig strand C 716..720 CDD:409353
Ig strand E 736..740 CDD:409353
Ig strand F 750..755 CDD:409353
Ig strand G 763..766 CDD:409353
IG_like 780..864 CDD:214653
Ig strand B 791..795 CDD:409353
Ig strand C 804..808 CDD:409353
Ig strand F 844..849 CDD:409353
I-set 870..957 CDD:400151
Ig strand B 887..891 CDD:409353
Ig strand C 901..905 CDD:409353
Ig strand E 923..927 CDD:409353
Ig strand F 937..942 CDD:409353
Ig strand G 950..953 CDD:409353
I-set 961..1048 CDD:400151
Ig strand B 978..982 CDD:409353
Ig strand C 991..995 CDD:409353
Ig strand E 1014..1018 CDD:409353
Ig strand F 1028..1033 CDD:409353
Ig 1065..1146 CDD:472250
Ig strand B 1076..1080 CDD:409353
Ig strand C 1089..1093 CDD:409353
Ig strand E 1112..1116 CDD:409353
Ig strand F 1126..1131 CDD:409353
Ig strand G 1139..1142 CDD:409353
Ig 1157..1237 CDD:472250
Ig strand B 1167..1171 CDD:409353
Ig strand C 1180..1184 CDD:409353
Ig strand E 1203..1207 CDD:409353
Ig strand F 1217..1222 CDD:409353
Ig strand G 1230..1233 CDD:409353
Ig 1241..1329 CDD:472250
Ig strand B 1259..1263 CDD:409353
Ig strand C 1272..1276 CDD:409353
Ig strand E 1295..1299 CDD:409353
Ig strand F 1309..1314 CDD:409353
Ig strand G 1322..1325 CDD:409353
I-set 1342..1420 CDD:400151
Ig strand B 1352..1356 CDD:409353
Ig strand C 1365..1369 CDD:409353
Ig strand E 1387..1392 CDD:409353
Ig strand F 1402..1407 CDD:409353
Ig strand G 1415..1418 CDD:409353
I-set 1434..1516 CDD:400151
Ig strand B 1445..1449 CDD:409353
Ig strand C 1458..1462 CDD:409353
Ig strand E 1481..1486 CDD:409353
Ig strand F 1496..1501 CDD:409353
I-set 1538..1609 CDD:400151
Ig strand B 1539..1543 CDD:409353
Ig strand C 1552..1556 CDD:409353
Ig strand E 1574..1579 CDD:409353
Ig strand F 1589..1594 CDD:409353
Ig strand G 1602..1605 CDD:409353
Ig 1621..1703 CDD:472250
Ig strand B 1633..1637 CDD:409353
Ig strand C 1646..1650 CDD:409353
Ig strand E 1668..1673 CDD:409353
Ig strand F 1683..1688 CDD:409353
I-set 1717..1796 CDD:400151 23/80 (29%)
Ig strand C 1739..1743 CDD:409353 1/3 (33%)
Ig strand E 1762..1766 CDD:409353 1/3 (33%)
Ig strand F 1776..1781 CDD:409353 2/4 (50%)
Ig 1796..1880 CDD:472250 31/106 (29%)
Ig strand B 1818..1822 CDD:409353 1/14 (7%)
Ig strand C 1831..1835 CDD:409353 0/3 (0%)
Ig strand F 1860..1865 CDD:409353 3/4 (75%)
Ig strand G 1873..1876 CDD:409353 0/2 (0%)
I-set 1886..1964 CDD:400151 25/130 (19%)
Ig strand B 1901..1905 CDD:409353 1/3 (33%)
Ig strand C 1914..1918 CDD:409353 1/3 (33%)
Ig strand E 1936..1941 CDD:409353 1/4 (25%)
Ig strand F 1951..1956 CDD:409353 3/4 (75%)
Ig 1984..2063 CDD:472250 23/95 (24%)
Ig strand B 1992..1996 CDD:409353 1/3 (33%)
Ig strand C 2005..2009 CDD:409353 0/3 (0%)
Ig strand E 2029..2033 CDD:409353 2/3 (67%)
Ig strand F 2043..2048 CDD:409353 2/4 (50%)
Ig strand G 2056..2059 CDD:409353 1/2 (50%)
Ig_3 2066..2141 CDD:464046 18/77 (23%)
Ig 2170..2246 CDD:472250 20/84 (24%)
Ig strand B 2176..2180 CDD:409353 0/3 (0%)
Ig strand C 2189..2193 CDD:409353 0/3 (0%)
Ig strand E 2204..2216 CDD:409353 2/14 (14%)
Ig strand F 2226..2231 CDD:409353 2/4 (50%)
Ig strand G 2239..2242 CDD:409353 0/2 (0%)
I-set 2259..2340 CDD:400151 25/105 (24%)
Ig strand B 2270..2274 CDD:409353 1/3 (33%)
Ig strand C 2283..2287 CDD:409353 0/3 (0%)
Ig strand E 2306..2310 CDD:409353 2/8 (25%)
Ig strand F 2320..2325 CDD:409353 2/4 (50%)
Ig 2364..2424 CDD:409353 15/61 (25%)
Ig strand B 2364..2368 CDD:409353 1/3 (33%)
Ig strand C 2377..2381 CDD:409353 0/4 (0%)
Ig strand E 2400..2404 CDD:409353 1/3 (33%)
Ig strand F 2414..2419 CDD:409353 3/4 (75%)
I-set 2447..2526 CDD:400151 19/80 (24%)
Ig strand B 2456..2460 CDD:409353 1/3 (33%)
Ig strand C 2469..2473 CDD:409353 1/3 (33%)
Ig strand E 2492..2496 CDD:409353 0/3 (0%)
Ig strand F 2506..2511 CDD:409353 1/4 (25%)
Ig strand G 2519..2522 CDD:409353 0/2 (0%)
I-set 2530..2622 CDD:400151 20/134 (15%)
Ig strand B 2552..2556 CDD:409353 0/3 (0%)
Ig strand C 2565..2569 CDD:409353 1/3 (33%)
Ig strand E 2588..2592 CDD:409353 3/12 (25%)
Ig strand F 2602..2607 CDD:409353 1/4 (25%)
I-set 2633..2720 CDD:400151 37/111 (33%)
Ig strand B 2650..2654 CDD:409353 2/3 (67%)
Ig strand C 2663..2667 CDD:409353 0/3 (0%)
Ig strand E 2686..2690 CDD:409353 0/3 (0%)
Ig strand F 2700..2705 CDD:409353 4/4 (100%)
Ig 2760..2830 CDD:472250 25/71 (35%)
Ig strand B 2760..2764 CDD:409353 1/3 (33%)
Ig strand C 2773..2777 CDD:409353 0/3 (0%)
Ig strand E 2797..2800 CDD:409353 1/4 (25%)
Ig strand F 2810..2815 CDD:409353 3/4 (75%)
I-set 2839..2925 CDD:400151 24/90 (27%)
Ig strand B 2855..2859 CDD:143224 2/5 (40%)
Ig strand C 2868..2872 CDD:143224 1/3 (33%)
Ig strand E 2891..2895 CDD:143224 1/3 (33%)
Ig strand F 2905..2910 CDD:143224 3/4 (75%)
Ig strand G 2918..2921 CDD:143224 1/2 (50%)
I-set 2929..3017 CDD:400151 24/98 (24%)
Ig strand B 2947..2951 CDD:409353 1/3 (33%)
Ig strand C 2960..2964 CDD:409353 1/3 (33%)
Ig strand E 2983..2987 CDD:409353 1/4 (25%)
Ig strand F 2997..3002 CDD:409353 1/4 (25%)
Ig strand G 3010..3013 CDD:409353 0/2 (0%)
I-set 3034..3111 CDD:400151 23/89 (26%)
Ig strand B 3041..3045 CDD:143207 1/3 (33%)
Ig strand C 3054..3058 CDD:143207 1/3 (33%)
Ig strand E 3077..3081 CDD:143207 1/3 (33%)
Ig strand F 3091..3096 CDD:143207 3/4 (75%)
Ig_3 3116..3189 CDD:464046 15/72 (21%)
Ig_3 3206..3284 CDD:464046 23/79 (29%)
I-set 3318..3391 CDD:400151 17/76 (22%)
Ig strand B 3321..3325 CDD:409353 1/3 (33%)
Ig strand C 3334..3338 CDD:409353 0/3 (0%)
Ig strand E 3357..3361 CDD:409353 1/3 (33%)
Ig strand F 3371..3376 CDD:409353 3/4 (75%)
I-set 3406..3484 CDD:400151 20/104 (19%)
Ig strand B 3414..3418 CDD:409353 0/3 (0%)
Ig strand C 3427..3431 CDD:409353 1/3 (33%)
Ig strand E 3450..3454 CDD:409353 1/4 (25%)
Ig strand F 3464..3469 CDD:409353 4/27 (15%)
Ig strand G 3477..3480 CDD:409353 1/2 (50%)
Ig 3488..3568 CDD:472250 20/98 (20%)
Ig strand B 3507..3511 CDD:409353 1/3 (33%)
Ig strand C 3520..3524 CDD:409353 1/3 (33%)
Ig strand E 3541..3545 CDD:409353 1/3 (33%)
Ig strand F 3555..3560 CDD:409353 1/4 (25%)
I-set 3585..3668 CDD:400151 22/97 (23%)
Ig strand B 3598..3602 CDD:409353 1/3 (33%)
Ig strand C 3611..3615 CDD:409353 0/3 (0%)
Ig strand E 3633..3638 CDD:409353 0/4 (0%)
Ig strand F 3648..3653 CDD:409353 2/4 (50%)
Ig strand G 3661..3664 CDD:409353 0/2 (0%)
I-set 3672..3759 CDD:400151 7/22 (32%)
Ig strand B 3689..3693 CDD:409353 2/3 (67%)
Ig strand C 3702..3706 CDD:409353
Ig strand E 3725..3729 CDD:409353
Ig strand F 3739..3744 CDD:409353
TSP1 3766..3817 CDD:214559
TSP1 3822..3873 CDD:214559
nidG2 3876..4088 CDD:469646
EGF_CA 4111..4149 CDD:214542
EGF_CA 4151..4184 CDD:429571
EGF_CA 4196..4233 CDD:214542
EGF_CA 4234..4267 CDD:214542
EGF_CA 4276..4307 CDD:429571
EGF_CA 4319..4348 CDD:429571
EGF_CA 4424..4463 CDD:214542
EGF_CA 4464..4504 CDD:214542
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.