DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp4aa1 and Cyp4d20

Sequence 1:NP_611067.2 Gene:Cyp4aa1 FlyBaseID:FBgn0034053 Length:510 Species:Drosophila melanogaster
Sequence 2:NP_647723.2 Gene:Cyp4d20 FlyBaseID:FBgn0035344 Length:510 Species:Drosophila melanogaster

Alignment Length:491 Identity:151/492 (31%)
Similarity:254/492 (52%) Gaps:52/492 (11%)


  Fly    48 LTGPPSLPFLGNC---MLVTDKDLMRRCAGKAFDLYGSLVRIWVLLFPFFAVLEPEDLQ---VIL 106
            :.||.|:|.|| |   .|....:.:....|:.||.||...|.|:|   ..:::..:|||   .||
  Fly    33 IPGPISIPILG-CGLQALHLGAENIIGWVGEKFDKYGKTFRFWIL---GESLIYTKDLQYFETIL 93

  Fly   107 SSKKHTNKVFFYRLMHNFLGDGLITSSGSKWSNHRRLIQPAFHHNLLEKFIDTFVDASQSLYENL 171
            ||.....|...|..:..||.|||:.|:|.||...|::...|||..:||.:::.....|..:.:||
  Fly    94 SSTTLLEKGQLYEYLRPFLNDGLLVSTGRKWHARRKIFTHAFHFKVLEHYVEIMDRHSSVMVDNL 158

  Fly   172 DAEAVG-TEINIAKYVNNCVLDILNEAVLGVPIKKRGQDVAMMEDSPFRQGKIMMPARFTQPWLL 235
            ...|.| |.:::.|||:...||::.||.:||.:..:       .|..|...|.:....:.||   
  Fly   159 RKVADGKTAVDMLKYVSLAALDVITEAAMGVQVNAQ-------NDPDFPYIKALKSVVYIQP--- 213

  Fly   236 LDGIYHWTKMAN------------DELNQKKRLNDFTRKMIQRRRQ---------------IQNN 273
             |.::.:::..|            ..|:..:.::|||.|:|..||:               :.:.
  Fly   214 -DRMFRFSRRYNWLFPLAAPLLHRQLLSDIRVMHDFTDKVISERRETVRRAKADGTYRPLSLGDA 277

  Fly   274 NNGNSERKCLLDHMIEISESNRDFTEEDIVNEACTFMLAGQDSVGAAVAFTLFLLTQNPECQDRC 338
            ..|:..:..|||.:::.|.:|:..::.||..|..|||..|.|:..:.|:..|:.:.::||.|.|.
  Fly   278 EIGSKSQMALLDILLQSSINNQPLSDADIREEVDTFMFEGDDTTSSGVSHALYAIARHPEVQQRI 342

  Fly   339 VLELATIFEDSNRAP-TMTDLHEMRYMEMCIKEALRLYPSVPLIARKLGEEVRLAKHTLPAGSNV 402
            ..||..:......|| |...|.:::|::..|||.:||||.||.|.|...:|:.:...|:||.:::
  Fly   343 FEELQRVLGPDASAPVTQAQLQDLKYLDCVIKETMRLYPPVPAIGRHAQKELEIGDKTIPANTSI 407

  Fly   403 FICPYATHRLAHIYPDPEKFQPERFSPENSENRHPYAFLPFSAGPRYCIGNRFAIMEIKTIVSRL 467
            ::..|..||.|:.:|||..|:||||..:..:..:.:|::||||||:.|||.:||::|:|.::|::
  Fly   408 YLVLYYAHRDANYFPDPLSFRPERFLEDQEQGHNTFAYVPFSAGPKNCIGQKFAVLEMKVLISKV 472

  Fly   468 LRSYQLLPVTGKTTIAATFRITLRASGGLWVRLKER 503
            ||.|:|||:..:  :.......||::.|:.|.|:.|
  Fly   473 LRFYELLPLGEE--LKPMLNFILRSASGINVGLRPR 506

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp4aa1NP_611067.2 p450 50..475 CDD:278495 144/460 (31%)
Cyp4d20NP_647723.2 p450 34..493 CDD:278495 145/476 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C114606746
eggNOG 1 0.900 E2759_KOG0157
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 120 1.000 Inparanoid score I1293
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24291
RoundUp 00.000 Not matched by this tool.
43.980

Return to query results.
Submit another query.