DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8299 and Tmprss6

DIOPT Version :9

Sequence 1:NP_611066.1 Gene:CG8299 / 36751 FlyBaseID:FBgn0034052 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_082178.2 Gene:Tmprss6 / 71753 MGIID:1919003 Length:811 Species:Mus musculus


Alignment Length:255 Identity:87/255 - (34%)
Similarity:132/255 - (51%) Gaps:43/255 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 ISTHIVGGDQADIADFPYQVSVRLETYMLLHICGGSIYAPRVVITAAHCIKGRYASYIRIVAGQN 88
            :|:.||||..:...::|:|.|:::..   .|||||::.|.|.|||||||.:            ::
Mouse   573 LSSRIVGGTVSSEGEWPWQASLQIRG---RHICGGALIADRWVITAAHCFQ------------ED 622

  Fly    89 SIADLE-----------------EQGVKVSKLIPHAGYNKKTYVNDIGLIITREPLEYSALVQPI 136
            |:|..:                 |...|||:|..|..:.:.::..|:.|:....|:.|||.|:|:
Mouse   623 SMASPKLWTVFLGKMRQNSRWPGEVSFKVSRLFLHPYHEEDSHDYDVALLQLDHPVVYSATVRPV 687

  Fly   137 AVALEAP--PSGAQAVVSGWGKRAEDDEALPAMLRAVELQIIEKSTCGAQYLTKDYTVTDEMLCA 199
            .:...:.  ..|....::|||.:.|.. .:...|:.|::|::.:..|...|   .|.|:..||||
Mouse   688 CLPARSHFFEPGQHCWITGWGAQREGG-PVSNTLQKVDVQLVPQDLCSEAY---RYQVSPRMLCA 748

  Fly   200 GYLEGGKDTCNGDSGGPLAV---DG--VLVGVVSWGVGCGREGFPGVYTSVNSHIDWIEE 254
            ||.:|.||.|.|||||||..   .|  .|.|:||||:||||..|.||||.|...|:||::
Mouse   749 GYRKGKKDACQGDSGGPLVCREPSGRWFLAGLVSWGLGCGRPNFFGVYTRVTRVINWIQQ 808

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8299NP_611066.1 Tryp_SPc 27..252 CDD:214473 84/248 (34%)
Tryp_SPc 28..255 CDD:238113 86/251 (34%)
Tmprss6NP_082178.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..48
SEA 88..185 CDD:279699
LDLa 459..489 CDD:238060
LDLa 495..525 CDD:238060
Ldl_recept_a 529..566 CDD:278486
Tryp_SPc 576..806 CDD:214473 84/248 (34%)
Tryp_SPc 577..809 CDD:238113 86/251 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.