DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8299 and si:dkey-21e2.15

DIOPT Version :9

Sequence 1:NP_611066.1 Gene:CG8299 / 36751 FlyBaseID:FBgn0034052 Length:260 Species:Drosophila melanogaster
Sequence 2:XP_003201076.1 Gene:si:dkey-21e2.15 / 567711 ZFINID:ZDB-GENE-050208-780 Length:251 Species:Danio rerio


Alignment Length:259 Identity:79/259 - (30%)
Similarity:122/259 - (47%) Gaps:27/259 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LGLFLLAALGVVILTDSASISTHIVGGDQADIADFPYQVSVRLETYMLLHICGGSIYAPRVVITA 69
            :.|.||.:| |..||.:|.:.  |..|.:|.....||.||::..:   .:.||||:.....|:||
Zfish     6 ISLLLLVSL-VPDLTFTARVG--IEDGTEAKPHSRPYMVSLQKNS---KNSCGGSLITEEFVLTA 64

  Fly    70 AHCIKGRYASYIRIVAGQNSIADLEE-QGVKVSKLIPHAGYNKKTYVNDIGLIITREPLEYSALV 133
            |||.|  ....|.:|.|.:.:::.|. ...:|:..|||..::.:.|.|||.|:...:.:..|..|
Zfish    65 AHCWK--KGDVITVVVGAHDLSENETYDSFEVTSYIPHPEFSWQNYENDIMLLKLNKKVTLSNNV 127

  Fly   134 QPIAVALEAPPSG------AQAVVSGWGKRAEDDEALPAMLRAVELQIIEKSTCGAQYLTKDYTV 192
            ..|::    |.:|      |...|:||| |...:...|..|...|..|:....|..::  :....
Zfish   128 GLISL----PKNGEDVKEDAVCSVAGWG-RLWLNGPRPDRLMEAETVIVSGEECKRRW--ESLFK 185

  Fly   193 TDEMLCAGYLEGGKDTCNGDSGGPLAVDGVLVGVVSWG--VGCGREGFPGVYTSVNSHIDWIEE 254
            ..:|.|. |..||  ||.|||||||......|||.|:.  ..|.....|.:||.:::::.||::
Zfish   186 PSKMFCV-YGHGG--TCKGDSGGPLVCGEHAVGVTSFSDRYSCNSRLLPNMYTKISAYLSWIQK 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8299NP_611066.1 Tryp_SPc 27..252 CDD:214473 69/233 (30%)
Tryp_SPc 28..255 CDD:238113 71/236 (30%)
si:dkey-21e2.15XP_003201076.1 Tryp_SPc 26..247 CDD:238113 71/236 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.