DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8299 and LOC562139

DIOPT Version :9

Sequence 1:NP_611066.1 Gene:CG8299 / 36751 FlyBaseID:FBgn0034052 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_001075159.1 Gene:LOC562139 / 562139 -ID:- Length:263 Species:Danio rerio


Alignment Length:270 Identity:89/270 - (32%)
Similarity:128/270 - (47%) Gaps:32/270 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LFLLAALGVV----------ILTDSASISTHIVGGDQADIADFPYQVSVRLETYMLLHICGGSIY 61
            |..||.:|..          ::|..|    .||.|::|....:|:|||::..|.  .|.||||:.
Zfish     7 LSCLALIGTAYGCGVPAIPPVITGYA----RIVNGEEAVPHSWPWQVSLQDSTG--FHFCGGSLI 65

  Fly    62 APRVVITAAHCIKGRYASYIRIVAGQNSIADLEE--QGVKVSKLIPHAGYNKKTYVNDIGLIITR 124
            ....|:|||||   ...:..|::.|::..:...|  |.:.|.|:..|..:|..|..|||.||...
Zfish    66 NEWWVVTAAHC---NVRTSHRVILGEHDRSSNAEPIQTMTVGKVFKHPNFNMFTINNDILLIKLA 127

  Fly   125 EPLEYSALVQPIAVA--LEAPPSGAQAVVSGWGKRAEDDEALPAMLRAVELQIIEKSTCGAQYLT 187
            .|.:.:..|.|:.:|  .:..|.|.:.|.||||....:....||:|:...|.::....|...:..
Zfish   128 TPAKINTHVSPVCLAETNDNFPGGMKCVTSGWGLTKHNAPDTPALLQQAALPLLTNEDCKRFWGN 192

  Fly   188 KDYTVTDEMLCAGYLEGGKDTCNGDSGGPLAV--DGV--LVGVVSWGVGCGREGFPGVYTSVNSH 248
            |   :||.|:|||  ..|..:|.|||||||..  |||  |||:||||........||||..|...
Zfish   193 K---ITDLMVCAG--ASGASSCMGDSGGPLVCQKDGVWTLVGIVSWGSSVCSTSSPGVYARVTKL 252

  Fly   249 IDWIEEQAEA 258
            ..|:::...|
Zfish   253 RAWVDQTITA 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8299NP_611066.1 Tryp_SPc 27..252 CDD:214473 81/232 (35%)
Tryp_SPc 28..255 CDD:238113 82/234 (35%)
LOC562139NP_001075159.1 Tryp_SPc 33..256 CDD:214473 81/232 (35%)
Tryp_SPc 34..259 CDD:238113 82/234 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.