DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8299 and tmprss9

DIOPT Version :9

Sequence 1:NP_611066.1 Gene:CG8299 / 36751 FlyBaseID:FBgn0034052 Length:260 Species:Drosophila melanogaster
Sequence 2:XP_021325244.1 Gene:tmprss9 / 562051 ZFINID:ZDB-GENE-050208-573 Length:788 Species:Danio rerio


Alignment Length:244 Identity:83/244 - (34%)
Similarity:129/244 - (52%) Gaps:24/244 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 ISTHIVGGDQADIADFPYQVSVRLETYMLLHICGGSIYAPRVVITAAHC--IKGRYASYIRIVAG 86
            :|..||||:.....:||:|||:||..   .|.||.||...|.:::||||  ::.....:..:| |
Zfish   228 MSNRIVGGENTRHGEFPWQVSLRLRG---RHTCGASIVNSRWLVSAAHCFEVENNPKDWTALV-G 288

  Fly    87 QNSIADLEEQG--VKVSKLIPHAGYNKKTYVNDIGLIITREPLEYSALVQPIAVALEAPPS---- 145
            .|.::..|.:.  |.:..|:....|:..|..:|:.::....||::|..|||:.:    |.|    
Zfish   289 ANQVSGAEAEAFIVNIKSLVMSPKYDPMTTDSDVTVLELETPLKFSHYVQPVCI----PSSSHVF 349

  Fly   146 --GAQAVVSGWGKRAEDDEALPAMLRAVELQIIEKSTCGAQYLTKDYTVTDEMLCAGYLEGGKDT 208
              |...:|||||...:....:|:.|:...::||:...|....:.:. .:|..|:|||:|:|..|:
Zfish   350 TPGQNCIVSGWGALNQYTTEVPSTLQKAIVKIIDSKVCNKSSVYRG-ALTQNMMCAGFLQGKVDS 413

  Fly   209 CNGDSGGPLAVDGV-----LVGVVSWGVGCGREGFPGVYTSVNSHIDWI 252
            |.||||||||.:..     |.|:|||||||.:...||||:.|....:||
Zfish   414 CQGDSGGPLACEVAAGRYFLAGIVSWGVGCAQINKPGVYSRVTKLRNWI 462

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8299NP_611066.1 Tryp_SPc 27..252 CDD:214473 80/239 (33%)
Tryp_SPc 28..255 CDD:238113 82/240 (34%)
tmprss9XP_021325244.1 SEA 52..146 CDD:307516
LDLa 185..220 CDD:238060
Tryp_SPc 232..462 CDD:238113 80/238 (34%)
LDLa 510..544 CDD:238060
Tryp_SPc 557..783 CDD:238113
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.