DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8299 and Prss33

DIOPT Version :9

Sequence 1:NP_611066.1 Gene:CG8299 / 36751 FlyBaseID:FBgn0034052 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_001102497.1 Gene:Prss33 / 497873 RGDID:1583742 Length:277 Species:Rattus norvegicus


Alignment Length:270 Identity:93/270 - (34%)
Similarity:133/270 - (49%) Gaps:25/270 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LGLFLLAALGVVILTDSA----SISTHIVGGDQADIADFPYQVSVRLETYMLLHICGGSIYAPRV 65
            |.:.||..||..:...:|    .:|:.||||..|...::|:|.|::   :...|:||||:.||:.
  Rat     7 LQILLLVVLGARMQECAACGQPRMSSRIVGGRDAQDGEWPWQTSIQ---HRGAHVCGGSLIAPQW 68

  Fly    66 VITAAHCIKGR-YASYIRIVAGQNS--IADLEEQGVKVSKLIPHAGYNKKTYVNDIGLIITREPL 127
            |:||.||...| ..|...::.|..|  :....|..|.|.:::....|::.....|:.|:....|:
  Rat    69 VLTAGHCFSRRVLPSEYSVLLGALSLDVTSSHELLVPVLRVLLPPDYSEDEARGDLALLQLSHPV 133

  Fly   128 EYSALVQPIAVALEA--PPSGAQAVVSGWGKRAEDDEALP--AMLRAVELQIIEKSTC------G 182
            ..||.:||:.:....  ||.|:...|:|||. ......||  ..|:.|.:.:::...|      |
  Rat   134 SLSARIQPVCLPAPGSHPPPGSPCWVTGWGS-LSPGVPLPKGRPLQGVRVPLLDSRACDRLYHMG 197

  Fly   183 AQYLTKDYTVTDEMLCAGYLEGGKDTCNGDSGGPLAV--DG--VLVGVVSWGVGCGREGFPGVYT 243
            |.....:..|....|||||..|.||.|.|||||||..  .|  |||||||||.||.....|||||
  Rat   198 ANVPKSERIVLPGNLCAGYRRGHKDACQGDSGGPLTCMESGRWVLVGVVSWGKGCALPNRPGVYT 262

  Fly   244 SVNSHIDWIE 253
            :|..:..||:
  Rat   263 NVAKYSPWIQ 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8299NP_611066.1 Tryp_SPc 27..252 CDD:214473 84/241 (35%)
Tryp_SPc 28..255 CDD:238113 86/243 (35%)
Prss33NP_001102497.1 Tryp_SPc 33..271 CDD:214473 84/241 (35%)
Tryp_SPc 34..272 CDD:238113 85/241 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.