DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8299 and CG4914

DIOPT Version :9

Sequence 1:NP_611066.1 Gene:CG8299 / 36751 FlyBaseID:FBgn0034052 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_648711.1 Gene:CG4914 / 39597 FlyBaseID:FBgn0036436 Length:374 Species:Drosophila melanogaster


Alignment Length:248 Identity:80/248 - (32%)
Similarity:134/248 - (54%) Gaps:26/248 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 THIVGGDQADIADFPYQVSVRLETYMLLHICGGSIYAPRVVITAAHCIKGRYASYIRIVAGQNSI 90
            :.||||....::::|:...:   :|.....|||::...|.|:|||||:||.....|::..|::..
  Fly   126 SRIVGGTTTGVSEYPWMARL---SYFNRFYCGGTLINDRYVLTAAHCVKGFMWFMIKVTFGEHDR 187

  Fly    91 ADLEEQGVKVSKLIPHAGYNK---KTYVNDIGLIITREPLEYSALVQPIAV-ALEAPPS---GAQ 148
            .:.:|:  ..::.:..|...|   ..:.|||.|:...:.:..::.::||.: .:|....   |.:
  Fly   188 CNDKER--PETRFVLRAFSQKFSFSNFDNDIALLRLNDRVPITSFIRPICLPRVEQRQDLFVGTK 250

  Fly   149 AVVSGWGKRAEDDEALPAMLRAVELQIIEKSTCGAQYLTKDYT---VTDEMLCAGYL-EGGKDTC 209
            |:.:|||...||.:. ..:|:.||:.:::...|.||   .:||   :|..|:|:||. .||:|:|
  Fly   251 AIATGWGTLKEDGKP-SCLLQEVEVPVLDNDECVAQ---TNYTQKMITKNMMCSGYPGVGGRDSC 311

  Fly   210 NGDSGGPLA---VDG---VLVGVVSWGVGCGREGFPGVYTSVNSHIDWIEEQA 256
            .|||||||.   .|.   ..:|:||||.||.|..:|||||.|..::|||.|.:
  Fly   312 QGDSGGPLVRLRPDDKRFEQIGIVSWGNGCARPNYPGVYTRVTKYLDWIVENS 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8299NP_611066.1 Tryp_SPc 27..252 CDD:214473 77/241 (32%)
Tryp_SPc 28..255 CDD:238113 79/243 (33%)
CG4914NP_648711.1 Tryp_SPc 127..360 CDD:214473 77/241 (32%)
Tryp_SPc 128..363 CDD:238113 79/243 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.