DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8299 and CG30414

DIOPT Version :9

Sequence 1:NP_611066.1 Gene:CG8299 / 36751 FlyBaseID:FBgn0034052 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_001163264.1 Gene:CG30414 / 37705 FlyBaseID:FBgn0050414 Length:305 Species:Drosophila melanogaster


Alignment Length:314 Identity:83/314 - (26%)
Similarity:128/314 - (40%) Gaps:81/314 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 FLLAALGVVI------------LTDSASISTH------IVGGDQADIADFPYQVSVRLETYMLLH 54
            |:.|.|.:::            |.||:..:|.      |.||..|.:...|:.|.|..|     .
  Fly     3 FIAAGLALLVCSIQLGEGAPGHLLDSSCGTTKPEFIPMITGGADAGLFSNPWMVKVLGE-----K 62

  Fly    55 ICGGSIYAPRVVITAAHCIKGRYASYIRIVAGQNSIA------------------------DLEE 95
            :||||:...|.|:||||||   .::::|:..|:....                        |...
  Fly    63 LCGGSLITSRFVLTAAHCI---VSTHMRVRLGEYKTRFPGKDCSRCVPKSYKLRRIRLGEYDTRF 124

  Fly    96 QG----------VKVSKLIPHAGYNKKTYVNDIGLIITREPLEYSALVQPIAVALEAPPSGAQAV 150
            .|          :.|.:.|.||.|| ....|||||:..:..::||..|:||.:.:|...:.:...
  Fly   125 PGKDCCVPKSYELAVDRKILHADYN-LNLDNDIGLLRMKSFVQYSDYVRPICLLVEGHMAESPIF 188

  Fly   151 -VSGWGKRAEDDEALPAMLRAVELQIIEKSTCGAQYLTKDYTVTDEMLCAGYLEGGKDTCNGDSG 214
             ::|||  ..:|......|:...:...:...|.::: ||.  |.:..:||.  ....|.|:||||
  Fly   189 NITGWG--VTNDGTPSRRLQRATVYNTDLHFCRSKF-TKQ--VDESQICAA--GTNSDACHGDSG 246

  Fly   215 GPLAVDGVLV--------GVVSWG-VGCGREGFPGVYTSVNSHIDWIEEQAEAY 259
            |||:......        |:||:| ..|  ..| .|||:|..|.|||....|.:
  Fly   247 GPLSAQVPFAGSWLTFQYGLVSYGSAAC--HSF-SVYTNVTHHRDWIVNAIEDF 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8299NP_611066.1 Tryp_SPc 27..252 CDD:214473 73/274 (27%)
Tryp_SPc 28..255 CDD:238113 75/270 (28%)
CG30414NP_001163264.1 Tryp_SPc 41..290 CDD:214473 73/267 (27%)
Tryp_SPc 41..290 CDD:238113 73/267 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.