DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8299 and CG8738

DIOPT Version :9

Sequence 1:NP_611066.1 Gene:CG8299 / 36751 FlyBaseID:FBgn0034052 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_610403.1 Gene:CG8738 / 35855 FlyBaseID:FBgn0033321 Length:459 Species:Drosophila melanogaster


Alignment Length:241 Identity:75/241 - (31%)
Similarity:123/241 - (51%) Gaps:26/241 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 ADFPYQVSVR-LETYMLLHICGGSIYAPRVVITAAHCIKGRYASYIRIVAGQ---NSIADLEEQG 97
            |:||:.|::. :|...   :|||::..|::|:|:||.:..|....:.:.||.   ||..:|....
  Fly   211 AEFPWMVALMDMEGNF---VCGGTLIHPQLVLTSAHNVFNRSEDSLLVRAGDWDLNSQTELHPYQ 272

  Fly    98 VK-VSKLIPHAGYNKKTYVNDIGLIITREPLEYSALVQPIAV------ALEAPPSGAQAVVSGWG 155
            :: :|:|..|..:|..|..|||.|::...|.:.:..:|||.:      .:||....|..:.:|||
  Fly   273 MRAISELHRHENFNNLTLYNDIALVVLERPFQVAPHIQPICLPPPETPQMEAELRSASCLATGWG 337

  Fly   156 KRAEDDEALPAMLRAVELQIIEKSTCGA----QYLTKDYTVTDEMLCAGYLEGGKDTCNGDSGGP 216
            .|......:..:|:.:||..::..:|..    ..|.:.|.:.....|||.:: |||||.||.|.|
  Fly   338 LRYSTSRTMENLLKRIELPAVDHESCQRLLRHTVLGRRYNLHPSFTCAGGVK-GKDTCMGDGGSP 401

  Fly   217 L--AVDG-----VLVGVVSWGVGCGREGFPGVYTSVNSHIDWIEEQ 255
            |  .:.|     .|||:||||:.|..:..|..||:|....:||:||
  Fly   402 LFCTLPGQKDRYQLVGLVSWGIECAEKDVPAAYTNVAYLRNWIDEQ 447

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8299NP_611066.1 Tryp_SPc 27..252 CDD:214473 71/236 (30%)
Tryp_SPc 28..255 CDD:238113 73/239 (31%)
CG8738NP_610403.1 Tryp_SPc 207..447 CDD:238113 73/239 (31%)
Tryp_SPc 207..444 CDD:214473 71/236 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.