DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8299 and CG30371

DIOPT Version :9

Sequence 1:NP_611066.1 Gene:CG8299 / 36751 FlyBaseID:FBgn0034052 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_610370.1 Gene:CG30371 / 35806 FlyBaseID:FBgn0050371 Length:399 Species:Drosophila melanogaster


Alignment Length:252 Identity:77/252 - (30%)
Similarity:118/252 - (46%) Gaps:26/252 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 SISTHIVGGDQADIADFPYQVSVRLETYMLLHICGGSIYAPRVVITAAHCI-KGRYASYIRIVAG 86
            |.:|.|..|.||...:||...:::..|......|||:|.|.|.::|||||| :...|:.|..:.|
  Fly   145 SATTRIANGQQAAANEFPSMAALKDVTKNQASFCGGTIVAHRYILTAAHCIYQVSRATNIVAIVG 209

  Fly    87 QNSIADLEE----QGVKVSKLIPHAGYNKKTYV-NDIGLIITREPLEYSALVQPIAVALEAPPSG 146
            .|.:.:...    |...:.::|||..|.....| |||.::||...:::|..|.||.:    ||.|
  Fly   210 TNDLGNPSSSRYYQQYNIQQMIPHEQYVSDPDVNNDIAVLITASNIQWSRGVGPICL----PPVG 270

  Fly   147 AQAV-------VSGWGKRAEDDEALP--AMLRAVELQIIEKSTCGAQYLTKDYTVTDEMLCAGYL 202
            ....       |.|:|...   .|.|  ..|:.:.|.::....|..:|.......|.:|....|.
  Fly   271 TSTPFTYDLVDVIGYGTVF---FAGPTSTSLQKINLNVVTNQDCQTEYNNVATIYTGQMCTYDYS 332

  Fly   203 EGGKDTCNGDSGGPLAV---DGVLVGVVSWGVGCGREGFP-GVYTSVNSHIDWIEEQ 255
            ..|:|:|..|||||:.:   ...|||::|:|..|....:| ||.|.:.|:|.||.::
  Fly   333 GTGRDSCQFDSGGPVILRKSRQFLVGIISYGKSCAESQYPMGVNTRITSYISWIRQK 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8299NP_611066.1 Tryp_SPc 27..252 CDD:214473 73/243 (30%)
Tryp_SPc 28..255 CDD:238113 75/245 (31%)
CG30371NP_610370.1 CUB 24..>67 CDD:294042
Tryp_SPc 149..386 CDD:214473 73/243 (30%)
Tryp_SPc 150..389 CDD:238113 75/245 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.