DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8299 and AgaP_AGAP007262

DIOPT Version :9

Sequence 1:NP_611066.1 Gene:CG8299 / 36751 FlyBaseID:FBgn0034052 Length:260 Species:Drosophila melanogaster
Sequence 2:XP_564960.3 Gene:AgaP_AGAP007262 / 3290331 VectorBaseID:AGAP007262 Length:316 Species:Anopheles gambiae


Alignment Length:255 Identity:79/255 - (30%)
Similarity:124/255 - (48%) Gaps:34/255 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 IVGGDQADIADFPYQVSVRLETYMLLHICGGSIYAPRVVITAAHCIKGRYASYIRIVAG------ 86
            ||.|.:|....|||||::..:....:.:||.||...|.|:|||||:      ||.:.|.      
Mosquito    66 IVNGQEARPGQFPYQVALLGQFNSGVGLCGASIITQRYVLTAAHCV------YIGVDASTPVANG 124

  Fly    87 -------QNSIADLEEQGV--KVSKLIPHAGYNKKTYVNDIGLIITREPLEYSALVQPIAVALEA 142
                   ...|.:..:|.:  ..|.:|.|.||:.....|||.::...||:.|:..:|||.:...:
Mosquito   125 TAILGAHNRMIEEPSQQRITFSASGVIGHPGYDLFDVRNDIAVVRLDEPILYTDRIQPIRLPGRS 189

  Fly   143 PP---SGAQAVVSGWGKRAEDDEALPAMLRAVELQIIEKSTCGAQYLTKDYTVTDEMLC-AGYLE 203
            ..   :|....|||:|..:..:..|..:|..|...:|..:.|.|.:...::.:..:.:| :|  :
Mosquito   190 DTRTFAGLMGTVSGYGVYSTANPGLSDVLNYVLNPVITNADCRAAWSGFEWLIEPQNVCQSG--D 252

  Fly   204 GGKDTCNGDSGGPLAV----DGVLVGVVSWGV--GCGREGFPGVYTSVNSHIDWIEEQAE 257
            ||:..||.||||||.|    :.:.|||||:|.  ||. .|.|.|:..|..::||||..::
Mosquito   253 GGRSACNSDSGGPLTVQDNGESLQVGVVSFGSAGGCD-NGIPTVFARVTYYLDWIEANSD 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8299NP_611066.1 Tryp_SPc 27..252 CDD:214473 76/248 (31%)
Tryp_SPc 28..255 CDD:238113 79/251 (31%)
AgaP_AGAP007262XP_564960.3 Tryp_SPc 65..306 CDD:214473 76/248 (31%)
Tryp_SPc 66..309 CDD:238113 79/251 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.