DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8299 and Klk14

DIOPT Version :9

Sequence 1:NP_611066.1 Gene:CG8299 / 36751 FlyBaseID:FBgn0034052 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_777355.1 Gene:Klk14 / 317653 MGIID:2447564 Length:250 Species:Mus musculus


Alignment Length:258 Identity:87/258 - (33%)
Similarity:136/258 - (52%) Gaps:19/258 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LFLLAALGVVILTDSASISTH-IVGGDQADIADFPYQVSVRLETYMLLH--ICGGSIYAPRVVIT 68
            |.:|.||.|.|   :.|...| |:||.:......|:||:::....   |  :|||.:.:.:.|||
Mouse     5 LIILQALAVAI---AQSQGDHKIIGGYRCVRNSQPWQVALQAGPG---HRFLCGGVLLSDQWVIT 63

  Fly    69 AAHCIKGRYASYIRIVAGQNSIADLE--EQGVKVSKLIPHAGYNKKTYVNDIGLIITREPLEYSA 131
            ||||.:    ..:.:..|:::|...|  :|.|:|::.:||..|..:.:.||:.|:..::.:....
Mouse    64 AAHCAR----PILHVALGKHNIRRWEATQQVVRVARQVPHPQYQPQAHDNDLMLLKLQKKVRLGR 124

  Fly   132 LVQPIAVALEAPPSGAQAVVSGWGKRAEDDEALPAMLRAVELQIIEKSTCGAQYLTKDYTVTDEM 196
            .|:.|:||......|....|||||..|......|..|:.|.:.|:.:..|...|   ...:|..|
Mouse   125 AVKTISVASSCASPGTPCRVSGWGTIASPIARYPTALQCVNVNIMSEQACHRAY---PGIITSGM 186

  Fly   197 LCAGYLEGGKDTCNGDSGGPLAVDGVLVGVVSWGV-GCGREGFPGVYTSVNSHIDWIEEQAEA 258
            :|||..|||||:|.|||||||...|.|.|:||||: .|...|:||||.::.::..||:...::
Mouse   187 VCAGVPEGGKDSCQGDSGGPLVCGGQLQGLVSWGMERCAMPGYPGVYANLCNYHSWIQRTMQS 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8299NP_611066.1 Tryp_SPc 27..252 CDD:214473 78/230 (34%)
Tryp_SPc 28..255 CDD:238113 79/231 (34%)
Klk14NP_777355.1 Tryp_SPc 24..246 CDD:238113 79/231 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000102
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.