DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8299 and Gzma

DIOPT Version :9

Sequence 1:NP_611066.1 Gene:CG8299 / 36751 FlyBaseID:FBgn0034052 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_034500.1 Gene:Gzma / 14938 MGIID:109266 Length:260 Species:Mus musculus


Alignment Length:258 Identity:86/258 - (33%)
Similarity:129/258 - (50%) Gaps:28/258 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LAALGVVILTDSASISTHIVGGDQADIADFPYQVSVRLETYMLLHICGGSIYAPRVVITAAHCIK 74
            ||.|..::|....... .|:|||.......||...::|.:..   ||.|::.....|:|||||..
Mouse    12 LATLLFLLLIPEGGCE-RIIGGDTVVPHSRPYMALLKLSSNT---ICAGALIEKNWVLTAAHCNV 72

  Fly    75 GRYASYIRIVAGQNSI-ADLEEQGVKVSKLIPHAGYNKKTYVNDIGLIITREPLEYSALVQPIAV 138
            |:.:.:|   .|.:|| .:.|:|.:.|.|..|:..|::.|...|:.|:    .|:..|.|.....
Mouse    73 GKRSKFI---LGAHSINKEPEQQILTVKKAFPYPCYDEYTREGDLQLV----RLKKKATVNRNVA 130

  Fly   139 ALEAPPS------GAQAVVSGWGKRAEDDEALPAMLRAVELQIIEKSTCGAQYLTKDY----TVT 193
            .|..|..      |.:..|:||| |..:..|....||.|.:.:|::..|..:   |.|    .:.
Mouse   131 ILHLPKKGDDVKPGTRCRVAGWG-RFGNKSAPSETLREVNITVIDRKICNDE---KHYNFHPVIG 191

  Fly   194 DEMLCAGYLEGGKDTCNGDSGGPLAVDGVLVGVVSW-GVGCGREGFPGVYTSV-NSHIDWIEE 254
            ..|:|||.|.||||:||||||.||..||:|.|:.|: |..||...:|||||.: :.|::||::
Mouse   192 LNMICAGDLRGGKDSCNGDSGSPLLCDGILRGITSFGGEKCGDRRWPGVYTFLSDKHLNWIKK 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8299NP_611066.1 Tryp_SPc 27..252 CDD:214473 80/237 (34%)
Tryp_SPc 28..255 CDD:238113 82/240 (34%)
GzmaNP_034500.1 Tryp_SPc 28..252 CDD:214473 80/237 (34%)
Tryp_SPc 29..255 CDD:238113 82/240 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.