DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8299 and F9

DIOPT Version :9

Sequence 1:NP_611066.1 Gene:CG8299 / 36751 FlyBaseID:FBgn0034052 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_032005.1 Gene:F9 / 14071 MGIID:88384 Length:471 Species:Mus musculus


Alignment Length:266 Identity:90/266 - (33%)
Similarity:142/266 - (53%) Gaps:37/266 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 LTDSASIS------------THIVGGDQADIADFPYQVSV--RLETYMLLHICGGSIYAPRVVIT 68
            :||.|.::            |.:|||:.|.....|:||.:  .:|.:     |||:|...:.::|
Mouse   215 ITDGAILNNVTESSESLNDFTRVVGGENAKPGQIPWQVILNGEIEAF-----CGGAIINEKWIVT 274

  Fly    69 AAHCIKGRYASYIRIVAGQNSIADLE--EQGVKVSKLIPHAGYNK--KTYVNDIGLIITREPLEY 129
            ||||:|.  ...|.:|||:.:|...|  ||...|.:.|||..||.  ..|.:||.|:...:||..
Mouse   275 AAHCLKP--GDKIEVVAGEYNIDKKEDTEQRRNVIRTIPHHQYNATINKYSHDIALLELDKPLIL 337

  Fly   130 SALVQPIAVALEAPPS----GAQAVVSGWGKRAEDDEALPAMLRAVELQIIEKSTCGAQYLTKDY 190
            ::.|.||.||.....:    .....|||||| ..:.....::|:.:.:.:::::||   ..:..:
Mouse   338 NSYVTPICVANREYTNIFLKFGSGYVSGWGK-VFNKGRQASILQYLRVPLVDRATC---LRSTTF 398

  Fly   191 TVTDEMLCAGYLEGGKDTCNGDSGGP--LAVDGV--LVGVVSWGVGCGREGFPGVYTSVNSHIDW 251
            |:.:.|.||||.|||||:|.||||||  ..|:|.  |.|::|||..|..:|..|:||.|:.:::|
Mouse   399 TIYNNMFCAGYREGGKDSCEGDSGGPHVTEVEGTSFLTGIISWGEECAMKGKYGIYTKVSRYVNW 463

  Fly   252 IEEQAE 257
            |:|:.:
Mouse   464 IKEKTK 469

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8299NP_611066.1 Tryp_SPc 27..252 CDD:214473 83/238 (35%)
Tryp_SPc 28..255 CDD:238113 85/240 (35%)
F9NP_032005.1 GLA 28..92 CDD:214503
EGF_CA 93..129 CDD:238011
FXa_inhibition 134..170 CDD:291342
Tryp_SPc 236..464 CDD:214473 83/238 (35%)
Tryp_SPc 237..467 CDD:238113 85/240 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.