DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8299 and Egfbp2

DIOPT Version :9

Sequence 1:NP_611066.1 Gene:CG8299 / 36751 FlyBaseID:FBgn0034052 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_034245.3 Gene:Egfbp2 / 13647 MGIID:95292 Length:261 Species:Mus musculus


Alignment Length:264 Identity:94/264 - (35%)
Similarity:137/264 - (51%) Gaps:30/264 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LFLLAALGVVILTDSA-SISTHIVGGDQADIADFPYQVSVRLETYMLLHICGGSIYAPRVVITAA 70
            |||..:||.:   |:| .:.:.:|||........|:||:|   .|...|||||.:.....|:|||
Mouse     6 LFLALSLGGI---DAAPPLQSRVVGGFNCKKNSQPWQVAV---YYQKEHICGGVLLDRNWVLTAA 64

  Fly    71 HCIKGRYASYIRIVAGQNSIADLEEQGVK---VSKLIPHAGYNKK-----------TYVNDIGLI 121
            ||...:|..::    |:|.:.. ||...:   |||..||.|:|..           .:.||:.|:
Mouse    65 HCYVDQYEVWL----GKNKLFQ-EEPSAQHRLVSKSFPHPGFNMSLLMLQTIPPGADFSNDLMLL 124

  Fly   122 ITREPLEYSALVQPIAVALEAPPSGAQAVVSGWGKRAEDDEALPAMLRAVELQIIEKSTCGAQYL 186
            ...:|.:.:.:|:|||:..:.|..|::.:.||||.........|..|:.|.:.::....|...||
Mouse   125 RLSKPADITDVVKPIALPTKEPKPGSKCLASGWGSITPTRWQKPDDLQCVFITLLPNENCAKVYL 189

  Fly   187 TKDYTVTDEMLCAGYLEGGKDTCNGDSGGPLAVDGVLVGVVSWG-VGCGREGFPGVYTSVNSHID 250
            .|   |||.|||||.:.||||||..||||||..||:|.|..|:| |.||:.|.|.:||::.....
Mouse   190 QK---VTDVMLCAGEMGGGKDTCRDDSGGPLICDGILQGTTSYGPVPCGKPGVPAIYTNLIKFNS 251

  Fly   251 WIEE 254
            ||::
Mouse   252 WIKD 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8299NP_611066.1 Tryp_SPc 27..252 CDD:214473 85/239 (36%)
Tryp_SPc 28..255 CDD:238113 87/242 (36%)
Egfbp2NP_034245.3 Tryp_SPc 24..253 CDD:214473 85/239 (36%)
Tryp_SPc 25..256 CDD:238113 87/242 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.