DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8299 and AgaP_AGAP001241

DIOPT Version :9

Sequence 1:NP_611066.1 Gene:CG8299 / 36751 FlyBaseID:FBgn0034052 Length:260 Species:Drosophila melanogaster
Sequence 2:XP_321913.5 Gene:AgaP_AGAP001241 / 1281929 VectorBaseID:AGAP001241 Length:267 Species:Anopheles gambiae


Alignment Length:231 Identity:78/231 - (33%)
Similarity:112/231 - (48%) Gaps:34/231 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 IVGGDQADIADFPYQVSVRLETYMLLHICGGSIYAPRVVITAAHCIKG-RYASYIRIVAGQNSIA 91
            ||||.:..|...|||||:|   |...|||||||.:...|:|||||:.. .:...|.:..|..|  
Mosquito    43 IVGGSKTTIESVPYQVSLR---YFNNHICGGSIISHSWVLTAAHCLDWYPHNDEITVRTGSTS-- 102

  Fly    92 DLEEQGVKVSKLI---PHAGYNKKTYVNDIGLIITREPLEYSALVQPIAVALEAP-PSGAQAVVS 152
              :..|..:..:.   .|..|:...:..|:..:..|.|:...|...||.:|.... ..|.:.:|:
Mosquito   103 --QSAGGSLHAVFYYHLHERYDPNEFQWDVATVRVRTPMGLGAGRAPIPLATSTEWTVGERILVT 165

  Fly   153 GWG-----KRAEDDEALPAMLRAVELQIIEKSTCGAQYLTKDYT--VTDEMLCAGYLEGGKDTCN 210
            |||     .:..|      .|:.:.|..:.:.:|     .:.:|  :|.:|||||  ..|.|.|.
Mosquito   166 GWGYLTAAGKVND------TLQMILLDAVPQESC-----NRTWTGFITADMLCAG--GPGVDACA 217

  Fly   211 GDSGGPLAVDGVLVGVVSWG-VGCGREGFPGVYTSV 245
            ||||||...|||..|:|||| :.|| .|.|||:|::
Mosquito   218 GDSGGPAVQDGVQYGIVSWGSIDCG-NGLPGVFTNI 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8299NP_611066.1 Tryp_SPc 27..252 CDD:214473 78/231 (34%)
Tryp_SPc 28..255 CDD:238113 78/231 (34%)
AgaP_AGAP001241XP_321913.5 Tryp_SPc 42..261 CDD:214473 78/231 (34%)
Tryp_SPc 43..264 CDD:238113 78/231 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D109274at50557
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.830

Return to query results.
Submit another query.