DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8299 and CLIPA4

DIOPT Version :9

Sequence 1:NP_611066.1 Gene:CG8299 / 36751 FlyBaseID:FBgn0034052 Length:260 Species:Drosophila melanogaster
Sequence 2:XP_552464.1 Gene:CLIPA4 / 1280862 VectorBaseID:AGAP011780 Length:422 Species:Anopheles gambiae


Alignment Length:261 Identity:75/261 - (28%)
Similarity:121/261 - (46%) Gaps:47/261 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 VGG----------DQADIADFPYQVSVRLETYMLLHICGGSIYAPRVVITAAHCIKGRYASYIRI 83
            :||          ::|...:||:.|:: ::|......||||:..|.:|:|.|||::|.....:::
Mosquito   148 IGGIDFTLTGNFNNEAGFGEFPWTVAI-IKTQDGSSTCGGSLIHPNLVLTGAHCVQGFRKGQLKV 211

  Fly    84 VAG----QNSIADLEEQGVKVSKLIPHAGYNKKTYVNDIGLIITREPLEYSALVQPIAVALEAPP 144
            .||    |.:...|..|...|:::..|..:|.::..|||.::....|::.:..:..:.:    ||
Mosquito   212 RAGEWDTQTTKERLPYQERAVTRVNSHPDFNPRSLANDIAVLELDSPIQPAEHINVVCL----PP 272

  Fly   145 SG-----AQAVVSGWGKRAEDDE-----ALPAMLRAVELQIIEKSTCGAQY----LTKDYTVTDE 195
            ..     .....|||||    |:     ....:::.|.|.::..|||..|.    ||..:.:...
Mosquito   273 VNFDTRRTDCFASGWGK----DQFGKAGRYSVIMKKVPLPLVPSSTCERQLQATRLTSRFRLHQT 333

  Fly   196 MLCAGYLEGGKDTCNGDSGGPLAVD-GVL-------VGVVSWGVGCGREGFPGVYTSVNSHIDWI 252
            .:|||. |.|.|||.||.|.||... |..       ||.|:||:|| .:..|||||:|.....||
Mosquito   334 FICAGG-ERGVDTCEGDGGAPLVCPIGAASENRYAQVGSVAWGIGC-HDAVPGVYTNVILFRSWI 396

  Fly   253 E 253
            :
Mosquito   397 D 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8299NP_611066.1 Tryp_SPc 27..252 CDD:214473 73/258 (28%)
Tryp_SPc 28..255 CDD:238113 75/261 (29%)
CLIPA4XP_552464.1 Tryp_SPc 161..399 CDD:238113 73/248 (29%)
Tryp_SPc 161..396 CDD:214473 71/245 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.