DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8299 and AgaP_AGAP006487

DIOPT Version :9

Sequence 1:NP_611066.1 Gene:CG8299 / 36751 FlyBaseID:FBgn0034052 Length:260 Species:Drosophila melanogaster
Sequence 2:XP_316522.4 Gene:AgaP_AGAP006487 / 1277089 VectorBaseID:AGAP006487 Length:281 Species:Anopheles gambiae


Alignment Length:265 Identity:72/265 - (27%)
Similarity:119/265 - (44%) Gaps:20/265 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LGLFLLAALGVVILTDSASISTHIVGGDQADIADFPYQVSVRLETYMLLHICGGSIYAPRVVITA 69
            |.|..||.||......|......:.||....:..:|  .:|.:||..:...|.|::...:.|:||
Mosquito     6 LVLAFLALLGSTQALPSDEAGPRVTGGTATLLGQYP--SAVIIETPYIPQNCMGTVVNRQHVLTA 68

  Fly    70 AHCIKGRYA------SYIRIVAGQNSIADL--EEQGVKVSKLIPHAGYNKKTYVNDIGLIITREP 126
            |.|:.....      .::|::||..:|..:  ..:..:|.:...|..||:.|..|::.::....|
Mosquito    69 ASCVMNPTTFVMINPFWLRVIAGDINIVPVSTRREVRQVIRSYVHPNYNRLTDGNNLAVLRVDVP 133

  Fly   127 L-EYSALVQPIAVALEAPPSGAQAVVSGWGKRAEDDEALPAMLR----AVELQIIEKSTCGAQYL 186
            . |:...::|..:.........|.|.:|||   .....:.|::|    .|...|:...:|.|..:
Mosquito   134 FPEFHNTIEPALLNARILADNTQCVFAGWG---ATQNQVTAVVRPNQFVVTQPILATVSCNAANV 195

  Fly   187 TKDYTVTDEMLCAGYLEGGKD-TCNGDSGGPLAVDGVLVGVVSWGVGCGREGFPGVYTSVNSHID 250
            ..: .|...|:|||.|...:: .|.|:.||.|..:|.|.||:::|:|||....||||..|..:..
Mosquito   196 HNN-RVQQTMICAGALAQSQNAVCRGNMGGGLYCNGRLTGVLAFGLGCGVANQPGVYMDVRQYTQ 259

  Fly   251 WIEEQ 255
            |||.|
Mosquito   260 WIETQ 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8299NP_611066.1 Tryp_SPc 27..252 CDD:214473 61/238 (26%)
Tryp_SPc 28..255 CDD:238113 64/240 (27%)
AgaP_AGAP006487XP_316522.4 Tryp_SPc 28..261 CDD:214473 61/238 (26%)
Tryp_SPc 29..264 CDD:238113 64/240 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.