DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8299 and AgaP_AGAP005195

DIOPT Version :9

Sequence 1:NP_611066.1 Gene:CG8299 / 36751 FlyBaseID:FBgn0034052 Length:260 Species:Drosophila melanogaster
Sequence 2:XP_314094.4 Gene:AgaP_AGAP005195 / 1274901 VectorBaseID:AGAP005195 Length:250 Species:Anopheles gambiae


Alignment Length:259 Identity:72/259 - (27%)
Similarity:135/259 - (52%) Gaps:29/259 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LFLLAALGVVILT----DSASIS--THIVGGDQADIADFPYQVSVRLETYMLLHICGGSIYAPRV 65
            :||...:.:|:|.    :::.:.  ..|:||...:....||.||:.:.::    :|||||.|.|.
Mosquito     1 MFLSGIVPLVLLVVHSLEASPVEPLAPIIGGSNVEDKKVPYLVSITVNSF----VCGGSIIADRW 61

  Fly    66 VITAAHCIKGRYASYIRIVAGQNSIADLEEQGV--KVSKLIPHAGYNKKTYVNDIGLIITREPLE 128
            ::|||||:|   .:.::..|.:....:....|.  ::.:.|.|..|.:..:.:|:||:..|.||:
Mosquito    62 ILTAAHCVK---RNMVKNAAVRVETNNFTASGTLYRIDRAIAHEKYFRGAFRDDVGLLRLRSPLK 123

  Fly   129 YSALVQPIAVALEAPPSGAQAVVSGWGKRAEDDEA--LPAMLRA--VELQIIEKSTCGAQYLTKD 189
            :...|:.|.:..:..|..|...:.|.|..::|::.  :..|::|  :.|::..|       :..|
Mosquito   124 FGERVKKIELLSQIVPYNATLTLVGRGYISKDNKTTKITQMIKAKNIALKLCRK-------MQPD 181

  Fly   190 YTVTDEMLCAGYLEGGKDTCNGDSGGPLAVDGVLVGVVSWGVGCGREGFPGVYTSVNSHIDWIE 253
            : :....||. :::.||.||:||||||:...|..||:|||..||| .|:..|::.::..:.||:
Mosquito   182 F-IYPGHLCT-FVKKGKGTCSGDSGGPVVWYGRQVGIVSWSKGCG-AGYFDVHSRISYFLPWIK 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8299NP_611066.1 Tryp_SPc 27..252 CDD:214473 66/230 (29%)
Tryp_SPc 28..255 CDD:238113 68/232 (29%)
AgaP_AGAP005195XP_314094.4 Tryp_SPc 28..244 CDD:238113 68/232 (29%)
Tryp_SPc 28..241 CDD:214473 66/229 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.