DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8299 and AgaP_AGAP000290

DIOPT Version :9

Sequence 1:NP_611066.1 Gene:CG8299 / 36751 FlyBaseID:FBgn0034052 Length:260 Species:Drosophila melanogaster
Sequence 2:XP_310831.5 Gene:AgaP_AGAP000290 / 1271969 VectorBaseID:AGAP000290 Length:499 Species:Anopheles gambiae


Alignment Length:260 Identity:77/260 - (29%)
Similarity:122/260 - (46%) Gaps:33/260 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 DSASISTHIVGGDQADIADFPYQVSVR--LETYMLLHICGGSIYAPRVVITAAHCIK------GR 76
            |...||..:.|  ....::||:.|::.  :.....::.|||::....||:|||||:.      .|
Mosquito   249 DGDGISQAVAG--PVGFSEFPWTVAIHQLIRNGSYVYHCGGALLNQSVVVTAAHCVSNNRLHPNR 311

  Fly    77 YASYIRIVAGQNSIADLEEQGVKVSKLIPHAGYNKKTYVNDIGLIITREPL-EYSALVQPIAVAL 140
            :..|......:::...|..|...||:::.|..|......||:.|:...||. :..|.|:|:.:  
Mosquito   312 FVVYAGDWDRRHTQERLPHQERTVSRVLVHPNYYSGALFNDLALLFFSEPFNDTVANVEPVCL-- 374

  Fly   141 EAPPSGAQAV------VSGWGKRAEDDEALPAMLRAVELQIIEKSTCGAQY-----LTKDYTVTD 194
             :.|||...:      |:|||...:.:.| .::.:..:||::|:..|..|.     |...:.:..
Mosquito   375 -SSPSGTDYIPPDNCFVTGWGGSPKGNRA-QSIQQYSKLQLVERHRCETQLQSLPTLGSKFKLHQ 437

  Fly   195 EMLCAGYLEGGKDTCNGDSGGPLAV--DG--VLVGVVSWGVGCGREGFPGVYTSVNSHIDWIEEQ 255
            ..:||.  ..|.|.|.|..|.|.|.  ||  .|||:|||||||| :|.|.|.|:|....:||..|
Mosquito   438 SFVCAA--TDGTDVCQGSGGSPYACERDGRYYLVGIVSWGVGCG-DGIPAVLTNVTELREWISRQ 499

  Fly   256  255
            Mosquito   500  499

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8299NP_611066.1 Tryp_SPc 27..252 CDD:214473 71/248 (29%)
Tryp_SPc 28..255 CDD:238113 73/250 (29%)
AgaP_AGAP000290XP_310831.5 Tryp_SPc 265..499 CDD:238113 72/240 (30%)
Tryp_SPc 265..496 CDD:214473 70/237 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.