DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8299 and LOC108647852

DIOPT Version :9

Sequence 1:NP_611066.1 Gene:CG8299 / 36751 FlyBaseID:FBgn0034052 Length:260 Species:Drosophila melanogaster
Sequence 2:XP_017950296.2 Gene:LOC108647852 / 108647852 -ID:- Length:416 Species:Xenopus tropicalis


Alignment Length:266 Identity:85/266 - (31%)
Similarity:131/266 - (49%) Gaps:32/266 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLAALGVVILTDSASISTHIVGGDQADIADFPYQVSVRL---ETYMLLHICGGSIYAPRVVITAA 70
            :|...|:..|..:......::.|:..:...:|:..|::|   :.|.  ..|||.:.:.|.|:|||
 Frog    25 ILKTCGIRPLVKNHHRVRRVIEGNTPEPGSWPWMASIQLLYKDGYG--SACGGVLLSNRWVVTAA 87

  Fly    71 HCIKG--RYASYIRIVAGQNSIADL--EEQGVKVSKLIPHAGYNKKTYVNDIGLIITREPLEYSA 131
            ||:..  ||....|||.|...:..|  |.|...:.:.|.|..::.||:.|||.||....|:::|.
 Frog    88 HCLSDLKRYRHLARIVLGARDLTQLGPETQIRTIKQWIQHEDFDHKTHKNDIALIRLNYPVKFSD 152

  Fly   132 LVQPIAVALEAPPSGAQAV------VSGWGKRAEDDEALPAMLRAVELQIIEKSTCGAQYLTKDY 190
            .:||..:    ||..:...      ::|||...|....:..||:...:::|::..|.    :.|:
 Frog   153 YIQPACL----PPKSSNVYKMDDCHIAGWGLLNEKPRTVTTMLQEATVELIDRKRCN----SSDW 209

  Fly   191 ---TVTDEMLCAGYLEGGKDTCNGDSGGPLAVD----GV--LVGVVSWGVGCGREGFPGVYTSVN 246
               .:.|:.|||||.:||.|.|.|||||||...    |:  :||:||||..||:....||||||.
 Frog   210 YNGGIHDDNLCAGYEQGGPDVCMGDSGGPLMCKRKKAGIYYVVGIVSWGGLCGQPHSNGVYTSVQ 274

  Fly   247 SHIDWI 252
            ....||
 Frog   275 DFEQWI 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8299NP_611066.1 Tryp_SPc 27..252 CDD:214473 80/246 (33%)
Tryp_SPc 28..255 CDD:238113 82/247 (33%)
LOC108647852XP_017950296.2 Tryp_SPc 44..280 CDD:238113 80/245 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.