DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8299 and Prss48

DIOPT Version :9

Sequence 1:NP_611066.1 Gene:CG8299 / 36751 FlyBaseID:FBgn0034052 Length:260 Species:Drosophila melanogaster
Sequence 2:XP_017446782.1 Gene:Prss48 / 108350052 RGDID:11436036 Length:308 Species:Rattus norvegicus


Alignment Length:247 Identity:90/247 - (36%)
Similarity:133/247 - (53%) Gaps:31/247 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 STHIVGGDQADIADFPYQVSVRLETYMLLHICGGSIYAPRVVITAAHCIKGRYASYIRIVAGQNS 89
            |..||||..|.:..:|:|||:|.::   .||||||:.:...|:|||||||..:.|::..|...:.
  Rat    37 SGRIVGGQGAALGHWPWQVSLRFDS---THICGGSLISNHWVMTAAHCIKKTWFSFLYSVWLGSI 98

  Fly    90 IADLEEQGVK--VSKL-IPHAGYNKKTYVNDIGLIITREPLEYSALVQPIAV-----ALEAPPSG 146
            ..|....|.:  ||:: ||...:|..   .||.|:.....:.:::||.||.:     .|..|   
  Rat    99 DRDYSSTGEEYYVSRIVIPSKHHNTD---GDIALLKLSSRVTFTSLVLPICLPNISKPLTVP--- 157

  Fly   147 AQAVVSGWGKRAEDDEALPAMLRAVELQIIEKSTCGAQYLTKDYTVTD-------EMLCAGYLEG 204
            |...|:|||:..|..  .|:.|:.:|:.||....|...|....:.:.|       :|||||.::.
  Rat   158 ASCWVTGWGQNQEGH--YPSTLQELEVPIITGEACEQLYNPIGFFLPDLERIIKEDMLCAGEIQQ 220

  Fly   205 GKDTCNGDSGGPLA--VDGV--LVGVVSWGVGCGREGFPGVYTSVNSHIDWI 252
            .||:|.|||||||:  :|||  .:||:|||:.||: ..|||||:|..:..||
  Rat   221 SKDSCKGDSGGPLSCHIDGVWTQIGVISWGLECGK-NLPGVYTNVTYYQKWI 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8299NP_611066.1 Tryp_SPc 27..252 CDD:214473 87/243 (36%)
Tryp_SPc 28..255 CDD:238113 89/244 (36%)
Prss48XP_017446782.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.