DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8299 and LOC102553861

DIOPT Version :9

Sequence 1:NP_611066.1 Gene:CG8299 / 36751 FlyBaseID:FBgn0034052 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_001316820.1 Gene:LOC102553861 / 102553861 RGDID:7500593 Length:248 Species:Rattus norvegicus


Alignment Length:265 Identity:87/265 - (32%)
Similarity:123/265 - (46%) Gaps:42/265 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LFLLAALGVVILTDSASISTHIVGGDQADIADFPYQVSVRL------ETYMLLHICGGSIYAPRV 65
            |.||..:.:...|::|    .|:||.:||....||...::.      :|     ||||.:.....
  Rat     4 LLLLLTVSLAPTTEAA----EIIGGHEADPHSRPYMAYLQYKNEDSRDT-----ICGGFLIREDF 59

  Fly    66 VITAAHCIKGRYASYIRIVAGQNSIADLE--EQGVKVSKLIPHAGYNKKTYVNDIGLIITREPLE 128
            |:|||||    ..|.|.:..|.::|.:.|  :|.:.|.|:|||..||.||..|||.|:..:...:
  Rat    60 VLTAAHC----SGSKINVTLGAHNIKEQEKTQQVIPVVKIIPHPAYNAKTISNDIMLLKLKSKAK 120

  Fly   129 YSALVQPIAVALEAPPS------GAQAVVSGWGKRAEDDEALPAMLRAVELQIIEKSTCGAQYLT 187
            .:..|:    .|..|.|      |....|:||||.....: .|..|:.|||.:.|...| ..||.
  Rat   121 RTRAVK----TLSLPRSNFKVKPGDVCYVAGWGKLGPMGK-FPDKLQEVELTVQEDQEC-ETYLK 179

  Fly   188 KDYTVTDEMLCAGYLEGGKDTC---NGDSGGPLAVDGVLVGVVSWGVGCGREGFPGVYTSVNSHI 249
            ..|...:: :|||   ..|..|   .|||||||....|..|:||:|...|  ..|..:|.|::.:
  Rat   180 NAYDKANQ-ICAG---DPKIKCASFQGDSGGPLVCKKVAAGIVSYGRKDG--STPRAFTKVSTFL 238

  Fly   250 DWIEE 254
            .||||
  Rat   239 SWIEE 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8299NP_611066.1 Tryp_SPc 27..252 CDD:214473 78/241 (32%)
Tryp_SPc 28..255 CDD:238113 82/244 (34%)
LOC102553861NP_001316820.1 Tryp_SPc 20..241 CDD:214473 78/241 (32%)
Tryp_SPc 21..244 CDD:238113 82/244 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.