DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: sli and LGR6

Sequence 1:NP_001261017.1 Gene:sli FlyBaseID:FBgn0264089 Length:2157 Species:Drosophila melanogaster
Sequence 2:NP_001017403.1 Gene:LGR6 HGNCID:19719 Length:967 Species:Homo sapiens

Alignment Length:896 Identity:199/897 (22%)
Similarity:297/897 (33%) Gaps:331/897 (37%)


  Fly   309 APMECGAENSCPHPCRC-ADGIV---DCREKSLTSVPVTLPDDTTELRLEQNFITELPPKSFSSF 369
            ||.......:||.||.| .|||:   ||.|..|::||..|...|..|.|..|.:|||.|..|...
Human    25 APQPGPGPTACPAPCHCQEDGIMLSADCSELGLSAVPGDLDPLTAYLDLSMNNLTELQPGLFHHL 89

  Fly   370 RRLRRIDLSNNNISRIAHDALSGLKQLTTLVLYGNKIKDLPSGVFKGLGSLQLLLLNANEISCIR 434
            |.|..:.||.|::|.|...|.|||..|..|:|..|::..:|:.....|.|||.|.|:||.||.:.
Human    90 RFLEELRLSGNHLSHIPGQAFSGLYSLKILMLQNNQLGGIPAEALWELPSLQSLRLDANLISLVP 154

  Fly   435 KDAFRDLHSLSLLSLYDNNIQSLANGTFDAMKSIKTVHLAKNPFICDCNLRWLADYLHKNPIETS 499
            :.:|..|.||..|.|.||.:..:.....:.:.:::.:.||.|      .:..:.||..:|.... 
Human   155 ERSFEGLSSLRHLWLDDNALTEIPVRALNNLPALQAMTLALN------RISHIPDYAFQNLTSL- 212

  Fly   500 GARCESPKRMHRRRIESLREEKFKCSWDELRMKLSGECRMDSDCPAMCHCEGTTVDCTGRGLKEI 564
                 ....:|..||:.|....|                           ||             
Human   213 -----VVLHLHNNRIQHLGTHSF---------------------------EG------------- 232

  Fly   565 PRDIPLHTTELL-LNDNELGRISSDGLFGRLPHLVKLELKRNQLTGIEPNAFEGASHIQELQLGE 628
                 ||..|.| ||.|:|...                          |.|......:|||....
Human   233 -----LHNLETLDLNYNKLQEF--------------------------PVAIRTLGRLQELGFHN 266

  Fly   629 NKIKEISNKMFLGLHQLKTLNLYDNQISCVMPGSFEHLNSLTSLNLASNPFNCNCHLAWFAEWLR 693
            |.||.|..|.|:|...|:|::.|||.|..|...:|::|..|.:|                     
Human   267 NNIKAIPEKAFMGNPLLQTIHFYDNPIQFVGRSAFQYLPKLHTL--------------------- 310

  Fly   694 KKSLNGGAARCGAPSKVRDVQIKDLPHSEFKCSSENSEGCLGDGYCPPSCTCTGTVVRCSRNQLK 758
              ||||.            :.|::.|..:...|.|                    ::..:|..::
Human   311 --SLNGA------------MDIQEFPDLKGTTSLE--------------------ILTLTRAGIR 341

  Fly   759 EIPRGIPAETSE---LYLESNEIEQIHYERIRHLRSLTRLDLSNNQITILSNYTFANLTKLSTLI 820
            .:|.|:..:...   |.|..|:||::  ..:...:.|..:.|.:|:|..:...||:.|:.|..|.
Human   342 LLPSGMCQQLPRLRVLELSHNQIEEL--PSLHRCQKLEEIGLQHNRIWEIGADTFSQLSSLQALD 404

  Fly   821 ISYNKLQCLQRHALSGLNNLRVLSLHGNRISMLPEGSFEDLKSLTHIALGSN------------- 872
            :|:|.::.:...|.|.|::|..|.|..|:::.||   ...|..|.|:.|..|             
Human   405 LSWNAIRSIHPEAFSTLHSLVKLDLTDNQLTTLP---LAGLGGLMHLKLKGNLALSQAFSKDSFP 466

  Fly   873 -------PLYCDC---GL---------KWFSDWIKLDYVEPG------IARCAEP--EQMKDKLI 910
                   |....|   |:         :|.::.:.||..|..      :||.||.  :|..|:|.
Human   467 KLRILEVPYAYQCCPYGMCASFFKASGQWEAEDLHLDDEESSKRPLGLLARQAENHYDQDLDELQ 531

  Fly   911 LSTPSSSFVCRGRVRNDILAKCNACFEQPCQNQAQCVALPQREYQCLCQPGYHGKHCEFMIDA-- 973
            |....|.                                |....||...||.. |.||::.::  
Human   532 LEMEDSK--------------------------------PHPSVQCSPTPGPF-KPCEYLFESWG 563

  Fly   974 --------------C---------YGNP-----------------------CRNNATCTVLEEGR 992
                          |         .|.|                       |...|:...|..|:
Human   564 IRLAVWAIVLLSVLCNGLVLLTVFAGGPVPLPPVKFVVGAIAGANTLTGISCGLLASVDALTFGQ 628

  Fly   993 FSCQCAPGYTGARCETNIDDC-------------------LGEIKCQNNATCIDGVESY------ 1032
            ||      ..|||.||.: .|                   |..::|..:.:|   |.:|      
Human   629 FS------EYGARWETGL-GCRATGFLAVLGSEASVLLLTLAAVQCSVSVSC---VRAYGKSPSL 683

  Fly  1033 --------KCECQPGFS--------GEF-----CDTKIQFCSPEFNPCANG 1062
                    .|....|.:        ||:     |   :.:..||..|.|.|
Human   684 GSVRAGVLGCLALAGLAAALPLASVGEYGASPLC---LPYAPPEGQPAALG 731

Known Domains:


GeneSequenceDomainRegion External IDIdentity
sliNP_001261017.1 leucine-rich repeat 126..149 CDD:275380
LRR_8 149..208 CDD:290566
leucine-rich repeat 150..173 CDD:275380
leucine-rich repeat 174..197 CDD:275380
LRR_8 197..256 CDD:290566
leucine-rich repeat 198..221 CDD:275380
leucine-rich repeat 222..245 CDD:275380
leucine-rich repeat 246..371 CDD:275380 27/66 (41%)
LRRCT 254..303 CDD:214507
LRRNT 319..350 CDD:214470 16/35 (46%)
LRR_8 349..406 CDD:290566 23/57 (40%)
LRR_4 371..411 CDD:289563 15/40 (38%)
leucine-rich repeat 372..395 CDD:275380 10/23 (43%)
leucine-rich repeat 396..415 CDD:275380 5/19 (26%)
leucine-rich repeat 420..443 CDD:275380 10/23 (43%)
leucine-rich repeat 444..465 CDD:275380 5/21 (24%)
leucine-rich repeat 468..480 CDD:275378 3/12 (25%)
LRRCT 476..525 CDD:214507 9/49 (18%)
leucine-rich repeat 484..545 CDD:275380 8/61 (13%)
LRRNT 542..574 CDD:214470 4/32 (13%)
leucine-rich repeat 552..570 CDD:275380 0/18 (0%)
leucine-rich repeat 572..596 CDD:275380 6/25 (24%)
LRR_RI <574..>678 CDD:238064 29/105 (28%)
LRR_8 595..655 CDD:290566 17/60 (28%)
leucine-rich repeat 597..620 CDD:275380 2/23 (9%)
leucine-rich repeat 621..644 CDD:275380 10/23 (43%)
leucine-rich repeat 645..668 CDD:275380 9/23 (39%)
leucine-rich repeat 669..756 CDD:275380 11/87 (13%)
LRRCT 677..726 CDD:214507 6/49 (12%)
LRRNT 739..770 CDD:214470 3/31 (10%)
leucine-rich repeat 757..791 CDD:275380 7/37 (19%)
LRRNT 73..103 CDD:214470
leucine-rich repeat 83..104 CDD:275380
LRR_8 102..160 CDD:290566
leucine-rich repeat 105..125 CDD:275380
LRR_RI <119..259 CDD:238064
LRR_4 770..807 CDD:289563 9/40 (23%)
LRR_8 790..850 CDD:290566 18/60 (30%)
LRR_4 791..830 CDD:289563 11/39 (28%)
leucine-rich repeat 792..815 CDD:275380 7/23 (30%)
LRR_4 814..863 CDD:289563 14/49 (29%)
leucine-rich repeat 816..839 CDD:275380 7/23 (30%)
leucine-rich repeat 840..861 CDD:275380 6/21 (29%)
LRRCT 872..920 CDD:214507 17/88 (19%)
EGF 935..966 CDD:278437 6/31 (19%)
EGF_CA 971..1007 CDD:238011 12/84 (14%)
EGF_CA 1009..1045 CDD:238011 10/82 (12%)
EGF_CA 1055..1086 CDD:238011 4/9 (44%)
EGF_CA 1088..1124 CDD:238011
Laminin_G_1 1204..1335 CDD:278483
CT 1435..1504 CDD:214482
LGR6NP_001017403.1 LRRNT 34..68 CDD:214470 15/34 (44%)
LRR_RI <57..199 CDD:238064 50/148 (34%)
leucine-rich repeat 70..91 CDD:275380 9/21 (43%)
LRR 1 91..112 8/21 (38%)
LRR_8 92..150 CDD:290566 23/58 (40%)
leucine-rich repeat 92..115 CDD:275380 10/23 (43%)
LRR 2 115..136 5/21 (24%)
leucine-rich repeat 116..139 CDD:275380 6/23 (26%)
LRR_RI 131..392 CDD:238064 82/401 (20%)
LRR 3 139..160 10/21 (48%)
leucine-rich repeat 140..163 CDD:275380 10/23 (43%)
LRR 4 163..186 6/23 (26%)
leucine-rich repeat 164..187 CDD:275380 5/23 (22%)
LRR_8 186..246 CDD:290566 20/117 (17%)
LRR 5 187..208 5/27 (19%)
leucine-rich repeat 188..211 CDD:275380 6/29 (21%)
LRR 6 211..232 6/54 (11%)
leucine-rich repeat 212..235 CDD:275380 9/74 (12%)
LRR 7 235..256 8/47 (17%)
leucine-rich repeat 236..258 CDD:275380 8/48 (17%)
LRR_8 258..314 CDD:290566 24/79 (30%)
LRR 8 258..279 9/21 (43%)
leucine-rich repeat 259..282 CDD:275380 10/23 (43%)
LRR 9 282..303 8/21 (38%)
leucine-rich repeat 283..304 CDD:275380 8/21 (38%)
LRR 10 306..328 8/57 (14%)
LRR 11 329..350 5/41 (12%)
leucine-rich repeat 330..344 CDD:275378 2/34 (6%)
LRR 12 353..374 5/23 (22%)
leucine-rich repeat 354..399 CDD:275380 12/47 (26%)
LRR_8 375..434 CDD:290566 18/59 (31%)
LRR 13 375..396 6/21 (29%)
leucine-rich repeat 376..390 CDD:275378 4/14 (29%)
LRR 14 399..420 6/21 (29%)
leucine-rich repeat 400..423 CDD:275380 7/23 (30%)
LRR 15 423..443 7/23 (30%)
leucine-rich repeat 424..444 CDD:275380 7/23 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR45836
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.