DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: sli and LRTM1

Sequence 1:NP_001261017.1 Gene:sli FlyBaseID:FBgn0264089 Length:2157 Species:Drosophila melanogaster
Sequence 2:NP_065729.1 Gene:LRTM1 HGNCID:25023 Length:345 Species:Homo sapiens

Alignment Length:266 Identity:78/267 (29%)
Similarity:114/267 (43%) Gaps:48/267 (18%)


  Fly   543 CPAMCHCEGTT--VDCTGRGLKEIPRDIPLHTTELLLNDNELGRISSDGLFGRLPHLVKLELKRN 605
            ||..|:|:.:|  |||:.:||.|||..:|..|..|.|.||::..:.:.. |..:|.|:.|.|..|
Human    21 CPDKCYCQSSTNFVDCSQQGLAEIPSHLPPQTRTLHLQDNQIHHLPAFA-FRSVPWLMTLNLSNN 84

  Fly   606 QLTGIEPNAFEGASHIQELQLGENKIKEISNKMFLGLHQLKTLNLYDNQISCVMPGS-------- 662
            .|:.:.|.||.|..|:|.|.|.:|.:..:.:::|..|.||:.|:|..|.|| .:|.|        
Human    85 SLSNLAPGAFHGLQHLQVLNLTQNSLLSLESRLFHSLPQLRELDLSSNNIS-HLPTSLGETWENL 148

  Fly   663 -----------------FEHLNSLTSLNLASNPFNCNCHLAWFAEWLRKKSLNGGAAR---CGAP 707
                             .|.:.|:..|.|..|.:.|||||.....||.|....||...   |.:|
Human   149 TILAVQQNQLQQLDRALLESMPSVRLLLLKDNLWKCNCHLLGLKLWLEKFVYKGGLTDGIICESP 213

  Fly   708 SKVRDVQIKDLPHSEFK-CSSENSEGCLGDGYCPPSCTCTGTVVRCSRN-----------QLKEI 760
            ...:...:..:||..:: |.....:........|.|  ..|.|:|...|           :||..
Human   214 DTWKGKDLLRIPHELYQPCPLPAPDPVSSQAQWPGS--AHGVVLRPPENHNAGERELLECELKPK 276

  Fly   761 PRGIPA 766
            ||  ||
Human   277 PR--PA 280

Known Domains:


GeneSequenceDomainRegion External IDIdentity
sliNP_001261017.1 leucine-rich repeat 126..149 CDD:275380
LRR_8 149..208 CDD:290566
leucine-rich repeat 150..173 CDD:275380
leucine-rich repeat 174..197 CDD:275380
LRR_8 197..256 CDD:290566
leucine-rich repeat 198..221 CDD:275380
leucine-rich repeat 222..245 CDD:275380
leucine-rich repeat 246..371 CDD:275380
LRRCT 254..303 CDD:214507
LRRNT 319..350 CDD:214470
LRR_8 349..406 CDD:290566
LRR_4 371..411 CDD:289563
leucine-rich repeat 372..395 CDD:275380
leucine-rich repeat 396..415 CDD:275380
leucine-rich repeat 420..443 CDD:275380
leucine-rich repeat 444..465 CDD:275380
leucine-rich repeat 468..480 CDD:275378
LRRCT 476..525 CDD:214507
leucine-rich repeat 484..545 CDD:275380 2/2 (100%)
LRRNT 542..574 CDD:214470 15/33 (45%)
leucine-rich repeat 552..570 CDD:275380 10/20 (50%)
leucine-rich repeat 572..596 CDD:275380 7/24 (29%)
LRR_RI <574..>678 CDD:238064 36/129 (28%)
LRR_8 595..655 CDD:290566 22/60 (37%)
leucine-rich repeat 597..620 CDD:275380 9/23 (39%)
leucine-rich repeat 621..644 CDD:275380 6/23 (26%)
leucine-rich repeat 645..668 CDD:275380 9/48 (19%)
leucine-rich repeat 669..756 CDD:275380 24/102 (24%)
LRRCT 677..726 CDD:214507 16/53 (30%)
LRRNT 739..770 CDD:214470 12/40 (30%)
leucine-rich repeat 757..791 CDD:275380 6/11 (55%)
LRRNT 73..103 CDD:214470
leucine-rich repeat 83..104 CDD:275380
LRR_8 102..160 CDD:290566
leucine-rich repeat 105..125 CDD:275380
LRR_RI <119..259 CDD:238064
LRR_4 770..807 CDD:289563
LRR_8 790..850 CDD:290566
LRR_4 791..830 CDD:289563
leucine-rich repeat 792..815 CDD:275380
LRR_4 814..863 CDD:289563
leucine-rich repeat 816..839 CDD:275380
leucine-rich repeat 840..861 CDD:275380
LRRCT 872..920 CDD:214507
EGF 935..966 CDD:278437
EGF_CA 971..1007 CDD:238011
EGF_CA 1009..1045 CDD:238011
EGF_CA 1055..1086 CDD:238011
EGF_CA 1088..1124 CDD:238011
Laminin_G_1 1204..1335 CDD:278483
CT 1435..1504 CDD:214482
LRTM1NP_065729.1 leucine-rich repeat 34..51 CDD:275380 9/17 (53%)
LRR_8 50..134 CDD:290566 28/85 (33%)
LRR 1 51..72 6/22 (27%)
leucine-rich repeat 52..75 CDD:275380 7/24 (29%)
LRR 2 75..96 8/21 (38%)
leucine-rich repeat 76..99 CDD:275380 9/23 (39%)
LRR_4 98..139 CDD:289563 15/42 (36%)
LRR 3 99..120 6/21 (29%)
leucine-rich repeat 100..123 CDD:275380 6/23 (26%)
LRR_8 122..181 CDD:290566 14/60 (23%)
LRR 4 123..144 9/22 (41%)
leucine-rich repeat 124..147 CDD:275380 8/24 (33%)
LRR 5 147..168 1/21 (5%)
leucine-rich repeat 148..171 CDD:275380 1/23 (4%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR45836
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.