DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: sli and rtn4r

Sequence 1:NP_001261017.1 Gene:sli FlyBaseID:FBgn0264089 Length:2157 Species:Drosophila melanogaster
Sequence 2:NP_982345.1 Gene:rtn4r ZFINID:ZDB-GENE-040310-1 Length:479 Species:Danio rerio

Alignment Length:589 Identity:126/590 (21%)
Similarity:191/590 (32%) Gaps:230/590 (39%)


  Fly    73 CPRVCSCTG---LNVDCSHRGLTSVPRKISADVERLELQGNNLTVIYETDFQRLTKLRMLQLTDN 134
            ||..|.|..   ..|.|..:||.|:|.:|....:|:.||.|.|||:..|.|..:..|.:|.:..|
Zfish    27 CPAKCVCYSEPKATVACQQQGLFSIPTEIPVRSQRIFLQSNKLTVVRSTSFSSVHNLTVLWMYSN 91

  Fly   135 QIHTIERNSFQDLVSLERLRLNNNRLKAIPENFVTSSASLLRLDISNNVITTVGRRVFKGAQSLR 199
            .|..||..:|..|..||                        .|||.                   
Zfish    92 NISHIEAGAFYGLERLE------------------------ELDIG------------------- 113

  Fly   200 SLQLDNNQITCLDEHAFKGLVELEILTLNNNNLTSLPHNIFGGLGRLRALRLSDNPFACDCHLSW 264
                ||:.:..:...||:||.:|..|.|:...|:.||..:|.||..|:.|.|.||          
Zfish   114 ----DNSNLRIISPTAFRGLTKLHTLHLHRCGLSELPVGVFRGLFSLQYLYLQDN---------- 164

  Fly   265 LSRFLRSATRLAPYTRCQSPSQLKGQNVADLHDQEFKCSGLTEHAPMECGAENSCPHPCRCADGI 329
                                      |:..||:..|                             
Zfish   165 --------------------------NLLALHEDTF----------------------------- 174

  Fly   330 VDCREKSLTSVPVTLPDDTTELRLEQNFITELPPKSFSSFRRLRRIDLSNNNISRIAHDALSGLK 394
                                                         :||:|               
Zfish   175 ---------------------------------------------LDLAN--------------- 179

  Fly   395 QLTTLVLYGNKIKDLPSGVFKGLGSLQLLLLNANEISCIRKDAFRDLHSLSLLSLYDNNIQSLAN 459
             ||.|.|:.||||.:...:.:||.:|..|||:.|.|..:::.||.||..|:.|.|:.||:..|..
Zfish   180 -LTYLFLHNNKIKVVTDHMLRGLVNLDRLLLHQNRIVHVQQQAFNDLSKLTTLFLFFNNLTMLTG 243

  Fly   460 GTFDAMKSIKTVHLAKNPFICDCNLRWLADYLHKNPIETSGARCESPKRMHRRRIESLREE---- 520
            .:.:.:.|::.:.|..|.:||||..|.|.|:..:....:|...|..|..::.:.::.|:.:    
Zfish   244 ESMNPLVSLQYLRLNGNQWICDCRARPLWDWFKRFKGSSSDLECHLPASLNGKDLKRLKSDDLEG 308

  Fly   521 --------------------KFKCSWDELRMKLSGECRMDSDCPAMCHCEG-------TTVDCTG 558
                                ||....|.|...:...|..|:|..::...:.       .:...|.
Zfish   309 CVDSPSQVQTSIFNSKVHSGKFLSLDDPLVESIPRCCLSDNDKSSIISSKSIPDPSSYNSRQITN 373

  Fly   559 RGLKEIP-------RDIPLHTTEL----LLNDNELGRISS--DGLFGRL-PHLVKLELKRNQLTG 609
            ..|||..       |::.....|.    .|||..||.:|:  |....|: |.|         |..
Zfish   374 NPLKEKENISKTKFREVERTKNETRNKQSLNDGPLGTMSNNLDQSLDRIDPEL---------LGN 429

  Fly   610 IEPN 613
            :||:
Zfish   430 LEPS 433

Known Domains:


GeneSequenceDomainRegion External IDIdentity
sliNP_001261017.1 leucine-rich repeat 126..149 CDD:275380 8/23 (35%)
LRR_8 149..208 CDD:290566 7/59 (12%)
leucine-rich repeat 150..173 CDD:275380 2/23 (9%)
leucine-rich repeat 174..197 CDD:275380 3/23 (13%)
LRR_8 197..256 CDD:290566 20/59 (34%)
leucine-rich repeat 198..221 CDD:275380 6/23 (26%)
leucine-rich repeat 222..245 CDD:275380 9/23 (39%)
leucine-rich repeat 246..371 CDD:275380 9/125 (7%)
LRRCT 254..303 CDD:214507 5/49 (10%)
LRRNT 319..350 CDD:214470 0/31 (0%)
LRR_8 349..406 CDD:290566 9/57 (16%)
LRR_4 371..411 CDD:289563 11/40 (28%)
leucine-rich repeat 372..395 CDD:275380 3/23 (13%)
leucine-rich repeat 396..415 CDD:275380 8/19 (42%)
leucine-rich repeat 420..443 CDD:275380 10/23 (43%)
leucine-rich repeat 444..465 CDD:275380 6/21 (29%)
leucine-rich repeat 468..480 CDD:275378 3/12 (25%)
LRRCT 476..525 CDD:214507 14/73 (19%)
leucine-rich repeat 484..545 CDD:275380 14/85 (16%)
LRRNT 542..574 CDD:214470 6/46 (13%)
leucine-rich repeat 552..570 CDD:275380 5/25 (20%)
leucine-rich repeat 572..596 CDD:275380 10/31 (32%)
LRR_RI <574..>678 CDD:238064 14/48 (29%)
LRR_8 595..655 CDD:290566 5/20 (25%)
leucine-rich repeat 597..620 CDD:275380 4/18 (22%)
leucine-rich repeat 621..644 CDD:275380
leucine-rich repeat 645..668 CDD:275380
leucine-rich repeat 669..756 CDD:275380
LRRCT 677..726 CDD:214507
LRRNT 739..770 CDD:214470
leucine-rich repeat 757..791 CDD:275380
LRRNT 73..103 CDD:214470 11/33 (33%)
leucine-rich repeat 83..104 CDD:275380 7/21 (33%)
LRR_8 102..160 CDD:290566 19/58 (33%)
leucine-rich repeat 105..125 CDD:275380 8/20 (40%)
LRR_RI <119..259 CDD:238064 34/140 (24%)
LRR_4 770..807 CDD:289563
LRR_8 790..850 CDD:290566
LRR_4 791..830 CDD:289563
leucine-rich repeat 792..815 CDD:275380
LRR_4 814..863 CDD:289563
leucine-rich repeat 816..839 CDD:275380
leucine-rich repeat 840..861 CDD:275380
LRRCT 872..920 CDD:214507
EGF 935..966 CDD:278437
EGF_CA 971..1007 CDD:238011
EGF_CA 1009..1045 CDD:238011
EGF_CA 1055..1086 CDD:238011
EGF_CA 1088..1124 CDD:238011
Laminin_G_1 1204..1335 CDD:278483
CT 1435..1504 CDD:214482
rtn4rNP_982345.1 leucine-rich repeat 40..57 CDD:275380 7/17 (41%)
LRR_8 60..115 CDD:290566 23/102 (23%)
leucine-rich repeat 60..82 CDD:275380 9/22 (41%)
leucine-rich repeat 83..106 CDD:275380 8/23 (35%)
leucine-rich repeat 107..131 CDD:275380 11/71 (15%)
leucine-rich repeat 132..155 CDD:275380 9/23 (39%)
LRR_8 155..214 CDD:290566 27/185 (15%)
leucine-rich repeat 156..179 CDD:275380 11/133 (8%)
leucine-rich repeat 180..203 CDD:275380 10/23 (43%)
LRR_8 203..261 CDD:290566 19/58 (33%)
leucine-rich repeat 204..227 CDD:275380 10/23 (43%)
leucine-rich repeat 228..251 CDD:275380 6/23 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR45836
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.