DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: sli and Nyx

Sequence 1:NP_001261017.1 Gene:sli FlyBaseID:FBgn0264089 Length:2157 Species:Drosophila melanogaster
Sequence 2:NP_775591.1 Gene:Nyx MGIID:2448607 Length:476 Species:Mus musculus

Alignment Length:494 Identity:116/495 (23%)
Similarity:173/495 (35%) Gaps:146/495 (29%)


  Fly    25 ILLLLRHDAVHAEPYSGGFGSSAVSSGGLGSVGIHIPGGGVGVITEA---RCPRVCSCT----GL 82
            :|:||.|..|.:.||:..                          |||   .||..|:|:    |.
Mouse     1 MLILLLHAVVFSLPYTRA--------------------------TEACLRACPAACTCSHVERGC 39

  Fly    83 NVDCSHRGLTSVPRKISADVERLELQGNNLTVIYETDFQRLTKLRMLQLTDNQIHTIERNSFQDL 147
            :|.|...||..||::...:...::|..|.|.::.|..|..|..||.|.|..|.:..|...:|:.|
Mouse    40 SVRCDRAGLQRVPQEFPCEAASIDLDRNGLRILGERAFGTLPSLRRLSLRHNNLSFITPGAFKGL 104

  Fly   148 VSLERLRL-NNNRLKAIPENFVTSSASLLRLDISNNVITTVGRRVFKGAQSLRSLQLDNNQITCL 211
            ..|..||| :|..|:.:......:...|.|||::...:.:|..|:.....:||.|...:|....:
Mouse   105 PRLAELRLAHNGELRYLHVRTFAALGRLRRLDLAACRLFSVPERLLAELPALRELTAFDNLFRRV 169

  Fly   212 DEHAFKGLVELEILTLNNNNLTSLPHNIFGGLGRLRALRLSDNPFACDCHLSWLSRFLRSATRLA 276
             ..|.:||..|.......:.:.::......|:.|||:|.|..|                      
Mouse   170 -PGALRGLANLTHAHFERSRIEAVASGSLLGMRRLRSLSLQAN---------------------- 211

  Fly   277 PYTRCQSPSQLKGQNVADLHDQEFKCSGLTEHAPMECGAENSCPHPCRCADGIVDCREKSLTSVP 341
                          .|..:|...|.          :|||                          
Mouse   212 --------------RVRAVHAGAFG----------DCGA-------------------------- 226

  Fly   342 VTLPDDTTELRLEQNFITELPPKSFSSFRRLRRIDLSNNNISRIAHDALSGLKQLTTLVLYGNKI 406
                  ..:|.|..|.:..||..:|...||||.::|..|.:..:|....|.|.:|..|.|..|.|
Mouse   227 ------LEDLLLNDNLLATLPAAAFRGLRRLRTLNLGGNALGSVARAWFSDLAELELLYLDRNSI 285

  Fly   407 KDLPSGVFKGLGSLQLLLLNANEISCIRKDAFRDLHSLSLLSLYDNNIQSLANGTFDAMKSIKTV 471
            ..:..|.|:.|..|..|.||.|.::.:...||:....|..|.|:                     
Mouse   286 TFVEEGAFQNLSGLLALHLNGNRLTVLSWAAFQPGFFLGRLFLF--------------------- 329

  Fly   472 HLAKNPFICDCNLRWLADYLHKNPIETSG----ARCESP 506
               :||:.|||.|.||.|::     |.||    ..|.||
Mouse   330 ---RNPWRCDCQLEWLRDWM-----EGSGRVADVACASP 360

Known Domains:


GeneSequenceDomainRegion External IDIdentity
sliNP_001261017.1 leucine-rich repeat 126..149 CDD:275380 8/23 (35%)
LRR_8 149..208 CDD:290566 16/60 (27%)
leucine-rich repeat 150..173 CDD:275380 6/24 (25%)
leucine-rich repeat 174..197 CDD:275380 6/23 (26%)
LRR_8 197..256 CDD:290566 15/59 (25%)
leucine-rich repeat 198..221 CDD:275380 7/23 (30%)
leucine-rich repeat 222..245 CDD:275380 2/23 (9%)
leucine-rich repeat 246..371 CDD:275380 18/125 (14%)
LRRCT 254..303 CDD:214507 4/49 (8%)
LRRNT 319..350 CDD:214470 0/31 (0%)
LRR_8 349..406 CDD:290566 19/57 (33%)
LRR_4 371..411 CDD:289563 13/40 (33%)
leucine-rich repeat 372..395 CDD:275380 7/23 (30%)
leucine-rich repeat 396..415 CDD:275380 7/19 (37%)
leucine-rich repeat 420..443 CDD:275380 7/23 (30%)
leucine-rich repeat 444..465 CDD:275380 3/21 (14%)
leucine-rich repeat 468..480 CDD:275378 2/12 (17%)
LRRCT 476..525 CDD:214507 15/36 (42%)
leucine-rich repeat 484..545 CDD:275380 10/28 (36%)
LRRNT 542..574 CDD:214470
leucine-rich repeat 552..570 CDD:275380
leucine-rich repeat 572..596 CDD:275380
LRR_RI <574..>678 CDD:238064
LRR_8 595..655 CDD:290566
leucine-rich repeat 597..620 CDD:275380
leucine-rich repeat 621..644 CDD:275380
leucine-rich repeat 645..668 CDD:275380
leucine-rich repeat 669..756 CDD:275380
LRRCT 677..726 CDD:214507
LRRNT 739..770 CDD:214470
leucine-rich repeat 757..791 CDD:275380
LRRNT 73..103 CDD:214470 11/34 (32%)
leucine-rich repeat 83..104 CDD:275380 6/21 (29%)
LRR_8 102..160 CDD:290566 19/59 (32%)
leucine-rich repeat 105..125 CDD:275380 6/20 (30%)
LRR_RI <119..259 CDD:238064 37/141 (26%)
LRR_4 770..807 CDD:289563
LRR_8 790..850 CDD:290566
LRR_4 791..830 CDD:289563
leucine-rich repeat 792..815 CDD:275380
LRR_4 814..863 CDD:289563
leucine-rich repeat 816..839 CDD:275380
leucine-rich repeat 840..861 CDD:275380
LRRCT 872..920 CDD:214507
EGF 935..966 CDD:278437
EGF_CA 971..1007 CDD:238011
EGF_CA 1009..1045 CDD:238011
EGF_CA 1055..1086 CDD:238011
EGF_CA 1088..1124 CDD:238011
Laminin_G_1 1204..1335 CDD:278483
CT 1435..1504 CDD:214482
NyxNP_775591.1 LRRNT 25..56 CDD:214470 11/31 (35%)
LRR 1 58..79 5/21 (24%)
leucine-rich repeat 63..82 CDD:275380 6/19 (32%)
LRR_RI <68..312 CDD:238064 73/323 (23%)
LRR_8 81..142 CDD:290566 18/61 (30%)
LRR 2 82..103 7/21 (33%)
leucine-rich repeat 83..106 CDD:275380 8/23 (35%)
LRR 3 106..128 6/22 (27%)
leucine-rich repeat 107..131 CDD:275380 6/24 (25%)
LRR_8 131..213 CDD:290566 21/119 (18%)
LRR 4 131..154 6/23 (26%)
leucine-rich repeat 132..155 CDD:275380 6/23 (26%)
LRR 5 155..177 7/23 (30%)
leucine-rich repeat 156..178 CDD:275380 7/23 (30%)
LRR 6 178..199 1/21 (5%)
leucine-rich repeat 179..202 CDD:275380 2/23 (9%)
LRR 7 202..223 9/67 (13%)
leucine-rich repeat 203..226 CDD:275380 10/69 (14%)
LRR 8 226..247 7/53 (13%)
leucine-rich repeat 227..250 CDD:275380 7/23 (30%)
LRR_8 249..309 CDD:290566 22/60 (37%)
LRR 9 250..271 7/21 (33%)
leucine-rich repeat 251..274 CDD:275380 7/23 (30%)
LRR 10 274..295 7/21 (33%)
leucine-rich repeat 275..296 CDD:275380 7/21 (33%)
LRR 11 298..319 7/21 (33%)
leucine-rich repeat 299..322 CDD:275378 7/23 (30%)
leucine-rich repeat 323..335 CDD:275378 5/36 (14%)
LRRCT 331..>366 CDD:214507 15/36 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG4237
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.