DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: sli and VASN

Sequence 1:NP_001261017.1 Gene:sli FlyBaseID:FBgn0264089 Length:2157 Species:Drosophila melanogaster
Sequence 2:NP_612449.2 Gene:VASN HGNCID:18517 Length:673 Species:Homo sapiens

Alignment Length:493 Identity:122/494 (25%)
Similarity:192/494 (39%) Gaps:96/494 (19%)


  Fly   543 CPAMCHC-EGTTVDCTGRGLKEIPRDIPLHTTELLLNDNELGRISSDGLFGRLPHLVKLELKRNQ 606
            ||:.|.| :..||.||.|....:|||:|..|..|.:.:|.:..:.: |.|..||.|..|:|.:||
Human    24 CPSGCQCSQPQTVFCTARQGTTVPRDVPPDTVGLYVFENGITMLDA-GSFAGLPGLQLLDLSQNQ 87

  Fly   607 LTGIEPNAFEGASHIQELQLGENKIKEISNKMFLGLHQLKTLNLYDNQISCVMPGSFEHLNSLTS 671
            :..:....|:..:::..|.|..|::.||:|:.|.||.:|:.|.|..|:|..:.||:|:.|:.|..
Human    88 IASLPSGVFQPLANLSNLDLTANRLHEITNETFRGLRRLERLYLGKNRIRHIQPGAFDTLDRLLE 152

  Fly   672 LNLASNPFNCNCHLAWFAEWLRKKSLNGGAARCGAPSKVRDVQIKDLPHSEFKCSSENSEGCLGD 736
            |.|..|..                       |...|.::..:.:.||.|        ||...|..
Human   153 LKLQDNEL-----------------------RALPPLRLPRLLLLDLSH--------NSLLALEP 186

  Fly   737 GYCPPSCTCTGTVVRCSRNQLKEIPRGIPAETSELY---LESNEIEQIHYERIRHLRSLTRLDLS 798
            |...   |.....:|.:...|:::..|:.:....|:   :..|::|::. ..||.||.||||.|:
Human   187 GILD---TANVEALRLAGLGLQQLDEGLFSRLRNLHDLDVSDNQLERVP-PVIRGLRGLTRLRLA 247

  Fly   799 -NNQITILSNYTFANLTKLSTLIISYNKLQCLQRHALSGLNNLRVLSLHGNRISMLPEGSFEDLK 862
             |.:|..|.....|.|..|..|.:|                ||.:.:|.|:...:.|.       
Human   248 GNTRIAQLRPEDLAGLAALQELDVS----------------NLSLQALPGDLSGLFPR------- 289

  Fly   863 SLTHIALGSNPLYCDCGLKWFSDWIKLDYV---EPGIARCAEPEQMKDKLILSTPSSSFVCRGRV 924
             |..:|...||..|.|.|.||..|::..:|   .|...||..|.:...:|:|....:.|.|....
Human   290 -LRLLAAARNPFNCVCPLSWFGPWVRESHVTLASPEETRCHFPPKNAGRLLLELDYADFGCPATT 353

  Fly   925 RNDILAKCNACFEQPCQNQAQCVAL------PQREYQC-----------LCQPGYHGKHCEFMID 972
            ....:........:|....:.....      |..|...           :.||           .
Human   354 TTATVPTTRPVVREPTALSSSLAPTWLSPTEPATEAPSPPSTAPPTVGPVPQP-----------Q 407

  Fly   973 ACYGNPCRNNATCTVLEEGRFSCQCAPGYTGARCETNI 1010
            .|..:.|.|..||.:......:|.|..|:||..||:.:
Human   408 DCPPSTCLNGGTCHLGTRHHLACLCPEGFTGLYCESQM 445

Known Domains:


GeneSequenceDomainRegion External IDIdentity
sliNP_001261017.1 leucine-rich repeat 126..149 CDD:275380
LRR_8 149..208 CDD:290566
leucine-rich repeat 150..173 CDD:275380
leucine-rich repeat 174..197 CDD:275380
LRR_8 197..256 CDD:290566
leucine-rich repeat 198..221 CDD:275380
leucine-rich repeat 222..245 CDD:275380
leucine-rich repeat 246..371 CDD:275380
LRRCT 254..303 CDD:214507
LRRNT 319..350 CDD:214470
LRR_8 349..406 CDD:290566
LRR_4 371..411 CDD:289563
leucine-rich repeat 372..395 CDD:275380
leucine-rich repeat 396..415 CDD:275380
leucine-rich repeat 420..443 CDD:275380
leucine-rich repeat 444..465 CDD:275380
leucine-rich repeat 468..480 CDD:275378
LRRCT 476..525 CDD:214507
leucine-rich repeat 484..545 CDD:275380 2/2 (100%)
LRRNT 542..574 CDD:214470 14/32 (44%)
leucine-rich repeat 552..570 CDD:275380 9/18 (50%)
leucine-rich repeat 572..596 CDD:275380 7/24 (29%)
LRR_RI <574..>678 CDD:238064 34/104 (33%)
LRR_8 595..655 CDD:290566 20/60 (33%)
leucine-rich repeat 597..620 CDD:275380 6/23 (26%)
leucine-rich repeat 621..644 CDD:275380 9/23 (39%)
leucine-rich repeat 645..668 CDD:275380 9/23 (39%)
leucine-rich repeat 669..756 CDD:275380 15/87 (17%)
LRRCT 677..726 CDD:214507 6/49 (12%)
LRRNT 739..770 CDD:214470 4/31 (13%)
leucine-rich repeat 757..791 CDD:275380 9/37 (24%)
LRRNT 73..103 CDD:214470
leucine-rich repeat 83..104 CDD:275380
LRR_8 102..160 CDD:290566
leucine-rich repeat 105..125 CDD:275380
LRR_RI <119..259 CDD:238064
LRR_4 770..807 CDD:289563 15/41 (37%)
LRR_8 790..850 CDD:290566 18/61 (30%)
LRR_4 791..830 CDD:289563 13/40 (33%)
leucine-rich repeat 792..815 CDD:275380 10/24 (42%)
LRR_4 814..863 CDD:289563 8/49 (16%)
leucine-rich repeat 816..839 CDD:275380 3/23 (13%)
leucine-rich repeat 840..861 CDD:275380 4/21 (19%)
LRRCT 872..920 CDD:214507 16/51 (31%)
EGF 935..966 CDD:278437 5/48 (10%)
EGF_CA 971..1007 CDD:238011 11/36 (31%)
EGF_CA 1009..1045 CDD:238011 0/3 (0%)
EGF_CA 1055..1086 CDD:238011
EGF_CA 1088..1124 CDD:238011
Laminin_G_1 1204..1335 CDD:278483
CT 1435..1504 CDD:214482
VASNNP_612449.2 LRRNT 23..54 CDD:214470 13/30 (43%)
leucine-rich repeat 34..56 CDD:275380 10/22 (45%)
LRR 1 52..74 5/23 (22%)
leucine-rich repeat 57..77 CDD:275380 6/21 (29%)
LRR_8 62..112 CDD:290566 14/51 (27%)
LRR_4 76..117 CDD:289563 12/41 (29%)
LRR 2 77..98 6/21 (29%)
leucine-rich repeat 78..101 CDD:275380 6/23 (26%)
LRR_8 101..158 CDD:290566 21/57 (37%)
LRR_4 101..141 CDD:289563 14/40 (35%)
LRR 3 101..122 7/21 (33%)
leucine-rich repeat 102..125 CDD:275380 9/23 (39%)
LRR_8 124..228 CDD:290566 28/138 (20%)
LRR 4 125..146 8/21 (38%)
leucine-rich repeat 126..149 CDD:275380 9/23 (39%)
LRR 5 149..170 6/44 (14%)
leucine-rich repeat 150..193 CDD:275380 14/77 (18%)
LRR 6 171..191 7/31 (23%)
LRR 7 193..214 3/21 (14%)
leucine-rich repeat 194..217 CDD:275380 3/23 (13%)
LRR_8 216..273 CDD:290566 20/74 (27%)
LRR 8 217..238 5/22 (23%)
leucine-rich repeat 218..240 CDD:275380 7/23 (30%)
LRR 9 240..262 9/22 (41%)
leucine-rich repeat 241..265 CDD:275380 10/24 (42%)
LRR 10 265..287 7/38 (18%)
leucine-rich repeat 266..286 CDD:275380 7/36 (19%)
LRRCT 298..349 CDD:214507 16/51 (31%)
EGF 409..440 CDD:278437 10/31 (32%)
fn3 466..535 CDD:278470
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.