DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: sli and nyx

Sequence 1:NP_001261017.1 Gene:sli FlyBaseID:FBgn0264089 Length:2157 Species:Drosophila melanogaster
Sequence 2:XP_017947306.1 Gene:nyx XenbaseID:XB-GENE-949924 Length:472 Species:Xenopus tropicalis

Alignment Length:438 Identity:105/439 (24%)
Similarity:171/439 (39%) Gaps:108/439 (25%)


  Fly    73 CPRVCSCT---GLNVDCSHRGLTSVPRKISADVERLELQGNNLTVIYETDFQRLTKLRMLQLTDN 134
            ||..|.||   ..:|.|...||..:|::...:...:.|..||:..:||..|..|..|:.|.|:.|
 Frog    33 CPSNCVCTQERSCSVLCDRIGLPEIPKEFPCEASFINLDKNNIKFLYERAFGTLPLLKGLSLSHN 97

  Fly   135 QIHTIERNSFQDLVSLERLRL-NNNRLKAIPENFVTSSASLLRLDISNNVITTVGRRVFKGAQSL 198
            .|..|...:|:.|.:|..|:: :|..::.:.....:....|::||:::..:..:..|:|....||
 Frog    98 NISFITPGAFKGLPNLTELKMAHNEYIRYLHTRTFSVLKKLVKLDLADCNLFNIPDRIFVELPSL 162

  Fly   199 RSLQLDNNQITCLDEHAFKGLVELEILTLNNNNLTSLPHNIFGGLGRLRALRLSDNPFACDCHLS 263
            ..|....|....: ..|.:|:..|..:.|.:|.:.::.:|....|..|:.|.|.||..       
 Frog   163 HELIFFQNNFRRI-PGAIRGMENLTHIYLESNRIEAVAYNSLQDLINLKYLNLQDNKI------- 219

  Fly   264 WLSRFLRSATRLAPYTRCQSPSQLKGQNVADLHDQEFKCSGLTEHAPMECGAENSCPHPCRCADG 328
                                       ||  :||:.|:                           
 Frog   220 ---------------------------NV--IHDRSFQ--------------------------- 228

  Fly   329 IVDCREKSLTSVPVTLPDDTTELRLEQNFITELPPKSFSSFRRLRRIDLSNNNISRIAHDALSGL 393
              ||::...             |.|..|.:.|||..||                        .||
 Frog   229 --DCQKLEY-------------LYLNDNLLNELPENSF------------------------KGL 254

  Fly   394 KQLTTLVLYGNKIKDLPSGVFKGLGSLQLLLLNANEISCIRKDAFRDLHSLSLLSLYDNNIQSLA 458
            |.|..|.|.||.|:::.|..|:.|..|::|.|:.|.||.|.:.||.:|.||..|.|..||:.:|.
 Frog   255 KCLKMLNLGGNFIRNVSSAWFQDLVELEVLYLDRNRISYIEEGAFENLTSLVTLHLNSNNLTTLP 319

  Fly   459 NGTFDAMKSIKTVHLAKNPFICDCNLRWLADYLHKNPIETSGARCESP 506
            ...|..:..:..:.|.:||:.|||.::||.|::....: .....|.:|
 Frog   320 FEVFRPVYFLGRLFLFRNPWECDCRIKWLQDWMDNYKL-VRDVPCSAP 366

Known Domains:


GeneSequenceDomainRegion External IDIdentity
sliNP_001261017.1 leucine-rich repeat 126..149 CDD:275380 8/23 (35%)
LRR_8 149..208 CDD:290566 12/60 (20%)
leucine-rich repeat 150..173 CDD:275380 3/24 (13%)
leucine-rich repeat 174..197 CDD:275380 5/23 (22%)
LRR_8 197..256 CDD:290566 16/59 (27%)
leucine-rich repeat 198..221 CDD:275380 5/23 (22%)
leucine-rich repeat 222..245 CDD:275380 5/23 (22%)
leucine-rich repeat 246..371 CDD:275380 20/125 (16%)
LRRCT 254..303 CDD:214507 6/49 (12%)
LRRNT 319..350 CDD:214470 2/31 (6%)
LRR_8 349..406 CDD:290566 16/57 (28%)
LRR_4 371..411 CDD:289563 9/40 (23%)
leucine-rich repeat 372..395 CDD:275380 3/23 (13%)
leucine-rich repeat 396..415 CDD:275380 8/19 (42%)
leucine-rich repeat 420..443 CDD:275380 10/23 (43%)
leucine-rich repeat 444..465 CDD:275380 7/21 (33%)
leucine-rich repeat 468..480 CDD:275378 3/12 (25%)
LRRCT 476..525 CDD:214507 10/32 (31%)
leucine-rich repeat 484..545 CDD:275380 5/24 (21%)
LRRNT 542..574 CDD:214470
leucine-rich repeat 552..570 CDD:275380
leucine-rich repeat 572..596 CDD:275380
LRR_RI <574..>678 CDD:238064
LRR_8 595..655 CDD:290566
leucine-rich repeat 597..620 CDD:275380
leucine-rich repeat 621..644 CDD:275380
leucine-rich repeat 645..668 CDD:275380
leucine-rich repeat 669..756 CDD:275380
LRRCT 677..726 CDD:214507
LRRNT 739..770 CDD:214470
leucine-rich repeat 757..791 CDD:275380
LRRNT 73..103 CDD:214470 10/33 (30%)
leucine-rich repeat 83..104 CDD:275380 5/21 (24%)
LRR_8 102..160 CDD:290566 18/59 (31%)
leucine-rich repeat 105..125 CDD:275380 7/20 (35%)
LRR_RI <119..259 CDD:238064 34/141 (24%)
LRR_4 770..807 CDD:289563
LRR_8 790..850 CDD:290566
LRR_4 791..830 CDD:289563
leucine-rich repeat 792..815 CDD:275380
LRR_4 814..863 CDD:289563
leucine-rich repeat 816..839 CDD:275380
leucine-rich repeat 840..861 CDD:275380
LRRCT 872..920 CDD:214507
EGF 935..966 CDD:278437
EGF_CA 971..1007 CDD:238011
EGF_CA 1009..1045 CDD:238011
EGF_CA 1055..1086 CDD:238011
EGF_CA 1088..1124 CDD:238011
Laminin_G_1 1204..1335 CDD:278483
CT 1435..1504 CDD:214482
nyxXP_017947306.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG4237
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.