DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: sli and lrrc3b

Sequence 1:NP_001261017.1 Gene:sli FlyBaseID:FBgn0264089 Length:2157 Species:Drosophila melanogaster
Sequence 2:NP_001082985.1 Gene:lrrc3b ZFINID:ZDB-GENE-070410-55 Length:258 Species:Danio rerio

Alignment Length:151 Identity:50/152 (33%)
Similarity:71/152 (47%) Gaps:34/152 (22%)


  Fly   739 CPPSCTCT-------GTVVRCSRNQLKEIPRGIPAETSELYLESNEIEQIHYERIRH-LRSLTRL 795
            ||..|||.       |..|.||.::|||||..:|.:|..|.|:.|.|..:. :||.| ||.|.||
Zfish    34 CPKGCTCQRSESPPHGLNVTCSLSRLKEIPPDVPPDTQLLQLDRNHISLVP-DRIFHGLRMLRRL 97

  Fly   796 DLSNNQITILSNYTFANLTKLSTLIISYNKLQCLQRHALSGLNNLRVLSLHGNRISMLPEGSFED 860
            :||:|.:..|....|..|.                       .:|.||.|..|||:.:.:.:|..
Zfish    98 NLSHNAVETLGEGAFIGLE-----------------------GSLEVLDLSYNRITSVHKDAFAR 139

  Fly   861 LKSLTHIALGSNPLYCDCGLK 881
            ||:  .:.:.:||.:|||.|:
Zfish   140 LKA--RVVVDNNPWHCDCALQ 158

Known Domains:


GeneSequenceDomainRegion External IDIdentity
sliNP_001261017.1 leucine-rich repeat 126..149 CDD:275380
LRR_8 149..208 CDD:290566
leucine-rich repeat 150..173 CDD:275380
leucine-rich repeat 174..197 CDD:275380
LRR_8 197..256 CDD:290566
leucine-rich repeat 198..221 CDD:275380
leucine-rich repeat 222..245 CDD:275380
leucine-rich repeat 246..371 CDD:275380
LRRCT 254..303 CDD:214507
LRRNT 319..350 CDD:214470
LRR_8 349..406 CDD:290566
LRR_4 371..411 CDD:289563
leucine-rich repeat 372..395 CDD:275380
leucine-rich repeat 396..415 CDD:275380
leucine-rich repeat 420..443 CDD:275380
leucine-rich repeat 444..465 CDD:275380
leucine-rich repeat 468..480 CDD:275378
LRRCT 476..525 CDD:214507
leucine-rich repeat 484..545 CDD:275380
LRRNT 542..574 CDD:214470
leucine-rich repeat 552..570 CDD:275380
leucine-rich repeat 572..596 CDD:275380
LRR_RI <574..>678 CDD:238064
LRR_8 595..655 CDD:290566
leucine-rich repeat 597..620 CDD:275380
leucine-rich repeat 621..644 CDD:275380
leucine-rich repeat 645..668 CDD:275380
leucine-rich repeat 669..756 CDD:275380 9/24 (38%)
LRRCT 677..726 CDD:214507
LRRNT 739..770 CDD:214470 16/38 (42%)
leucine-rich repeat 757..791 CDD:275380 16/35 (46%)
LRRNT 73..103 CDD:214470
leucine-rich repeat 83..104 CDD:275380
LRR_8 102..160 CDD:290566
leucine-rich repeat 105..125 CDD:275380
LRR_RI <119..259 CDD:238064
LRR_4 770..807 CDD:289563 16/38 (42%)
LRR_8 790..850 CDD:290566 16/60 (27%)
LRR_4 791..830 CDD:289563 9/39 (23%)
leucine-rich repeat 792..815 CDD:275380 9/23 (39%)
LRR_4 814..863 CDD:289563 10/49 (20%)
leucine-rich repeat 816..839 CDD:275380 0/23 (0%)
leucine-rich repeat 840..861 CDD:275380 8/21 (38%)
LRRCT 872..920 CDD:214507 6/11 (55%)
EGF 935..966 CDD:278437
EGF_CA 971..1007 CDD:238011
EGF_CA 1009..1045 CDD:238011
EGF_CA 1055..1086 CDD:238011
EGF_CA 1088..1124 CDD:238011
Laminin_G_1 1204..1335 CDD:278483
CT 1435..1504 CDD:214482
lrrc3bNP_001082985.1 LRRNT 34..72 CDD:214470 16/38 (42%)
LRR 1 69..90 8/22 (36%)
leucine-rich repeat 70..93 CDD:275378 10/24 (42%)
LRR_8 73..129 CDD:290566 24/80 (30%)
LRR 2 93..114 8/21 (38%)
LRR_4 94..132 CDD:289563 16/61 (26%)
leucine-rich repeat 94..118 CDD:275378 9/47 (19%)
LRR 3 118..139 8/21 (38%)
leucine-rich repeat 119..142 CDD:275378 10/23 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG4237
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.