DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8204 and ZNHIT3

Sequence 1:NP_001286464.1 Gene:CG8204 FlyBaseID:FBgn0034033 Length:143 Species:Drosophila melanogaster
Sequence 2:NP_004764.1 Gene:ZNHIT3 HGNCID:12309 Length:155 Species:Homo sapiens

Alignment Length:146 Identity:56/147 (38%)
Similarity:75/147 (51%) Gaps:16/147 (11%)


  Fly     4 CIICVDNLRKYKCSKCSAPYCSVACYKTHRDSPQCATRESDLKKTEVGYQEEPTLHVPFPTDDTV 68
            |:||::. .||:|..|..|||||.|::.|::.....||..: ||.......:....|....||..
Human    11 CVICLEK-PKYRCPACRVPYCSVVCFRKHKEQCNPETRPVE-KKIRSALPTKTVKPVENKDDDDS 73

  Fly    69 AAE-----------KLQQLENCQE---LRNLLHNPHLRSLLQQIDVAINAQSAMMAAMQEPLFVE 119
            .|:           .||.|:|..|   ||:||.|||||.|:..:|...:....|.|.||||||||
Human    74 IADFLNSDEEEDRVSLQNLKNLGESATLRSLLLNPHLRQLMVNLDQGEDKAKLMRAYMQEPLFVE 138

  Fly   120 FANACLQVVEPMTDAE 135
            ||:.||.:|||..:.|
Human   139 FADCCLGIVEPSQNEE 154

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8204NP_001286464.1 zf-HIT 1..30 CDD:282314 13/26 (50%)
ZNHIT3NP_004764.1 zf-HIT 7..36 CDD:309543 13/26 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C196871215
eggNOG 1 0.900 E1_KOG2857
Hieranoid 1 1.000
Homologene 1 1.000 H37964
Inparanoid 1 1.050 92 1.000 Inparanoid score I5006
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1551354at2759
OrthoFinder 1 1.000 FOG0006188
OrthoInspector 1 1.000 T1072242
orthoMCL 1 0.900 OOG5_130154
Panther 1 1.100 LDO PTHR13483
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R130
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1413.800

Return to query results.
Submit another query.