DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8204 and BCD1

DIOPT Version :9

Sequence 1:NP_001286464.1 Gene:CG8204 / 36728 FlyBaseID:FBgn0034033 Length:143 Species:Drosophila melanogaster
Sequence 2:NP_011906.1 Gene:BCD1 / 856436 SGDID:S000001082 Length:366 Species:Saccharomyces cerevisiae


Alignment Length:81 Identity:20/81 - (24%)
Similarity:34/81 - (41%) Gaps:19/81 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 CIICVDNLRKYKCSKCSAPYCSVACYKTHRDSPQCATRESDLKKTEVGYQEEPTLHVPFPTDDTV 68
            |.:|.....||||.:|....||:.|.|.|:....|:.:..|.|                   :.:
Yeast     5 CGVCGIKEFKYKCPRCLVQTCSLECSKKHKTRDNCSGQTHDPK-------------------EYI 50

  Fly    69 AAEKLQQLENCQELRN 84
            ::|.|:|.::.:..||
Yeast    51 SSEALKQADDDKHERN 66

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8204NP_001286464.1 zf-HIT 1..30 CDD:282314 10/25 (40%)
BCD1NP_011906.1 zf-HIT 1..31 CDD:398237 10/25 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R130
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.