DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8204 and HIT1

Sequence 1:NP_001286464.1 Gene:CG8204 FlyBaseID:FBgn0034033 Length:143 Species:Drosophila melanogaster
Sequence 2:NP_012589.1 Gene:HIT1 SGDID:S000003816 Length:164 Species:Saccharomyces cerevisiae

Alignment Length:134 Identity:40/135 (30%)
Similarity:62/135 (46%) Gaps:19/135 (14%)


  Fly     3 KCIIC--VDNLRKYKCSKCSAPYCSVACYK-----THRDSPQCATRESDLKKTEVGYQEEPTLHV 60
            ||.||  ||.  ||||.||...|||:.|||     .|::|.|  .|.......|| ...:..::.
Yeast     7 KCGICRGVDG--KYKCPKCGVRYCSLKCYKDAAKHVHKESEQ--PRAGTEANVEV-VNNDKIINS 66

  Fly    61 PFPTDDTVAAEKLQQL-ENCQELRNLL-HNP---HLRSLLQQIDVAINAQSA--MMAAMQEPLFV 118
            ....:.|:..:....: :|..||:.|| :|.   ||..:.:.:...:|..|:  |.:.:|:.|.|
Yeast    67 SLAMNKTLKTKAFDDIYQNSAELQELLKYNTVKFHLAKVYRILSSTVNDGSSGKMNSDLQKELAV 131

  Fly   119 EFAN 122
            .:.|
Yeast   132 NYLN 135

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8204NP_001286464.1 zf-HIT 1..30 CDD:282314 17/29 (59%)
HIT1NP_012589.1 zf-HIT 4..34 CDD:282314 17/29 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 43 1.000 Inparanoid score I1853
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T1135530
orthoMCL 1 0.900 OOG5_130154
Panther 1 1.100 LDO PTHR13483
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R130
TreeFam 00.000 Not matched by this tool.
66.080

Return to query results.
Submit another query.