DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8204 and AT4G28820

Sequence 1:NP_001286464.1 Gene:CG8204 FlyBaseID:FBgn0034033 Length:143 Species:Drosophila melanogaster
Sequence 2:NP_001329310.1 Gene:AT4G28820 AraportID:AT4G28820 Length:181 Species:Arabidopsis thaliana

Alignment Length:169 Identity:48/170 (28%)
Similarity:66/170 (39%) Gaps:37/170 (22%)


  Fly     2 EKCIICVDNLRKYKCSKCSAPYCSVACYKTHRDSPQCATRESDLKKTEVGYQEEPTLHVPF--PT 64
            :.|.||...:.||||..|..||||:.|:|.|:::| || :.||...||......|...||.  |.
plant     7 QTCEICEKVVSKYKCPSCLVPYCSLGCFKIHKETP-CA-KPSDPSSTEEKPAASPAKEVPVKRPE 69

  Fly    65 DDTVAAEKLQQ-------------------------LENCQ--------ELRNLLHNPHLRSLLQ 96
            :.....||.||                         ||..|        |:|..|.:..|:.|:.
plant    70 EANDVVEKTQQKASAASPAKEIPVARPIIVEEEKYILEKTQFEAIASSSEIREALKDEPLQKLIY 134

  Fly    97 QIDVAINAQSAMMAAMQEPLFVEFANACLQVVEPMTDAE 135
            .||.:.|....:..||....|.||.:..|..:....|.:
plant   135 SIDSSSNPLQELDEAMGIEAFREFTDKILSNISKSNDEQ 173

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8204NP_001286464.1 zf-HIT 1..30 CDD:282314 13/28 (46%)
AT4G28820NP_001329310.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 60 1.000 Inparanoid score I2479
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1551354at2759
OrthoInspector 1 1.000 T192808
orthoMCL 1 0.900 OOG5_130154
Panther 1 1.100 LDO PTHR13483
Phylome 1 0.910 0.667 Consistency score
76.970

Return to query results.
Submit another query.