DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8204 and AT4G28820

DIOPT Version :9

Sequence 1:NP_001286464.1 Gene:CG8204 / 36728 FlyBaseID:FBgn0034033 Length:143 Species:Drosophila melanogaster
Sequence 2:NP_001329310.1 Gene:AT4G28820 / 829003 AraportID:AT4G28820 Length:181 Species:Arabidopsis thaliana


Alignment Length:169 Identity:48/169 - (28%)
Similarity:66/169 - (39%) Gaps:37/169 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 EKCIICVDNLRKYKCSKCSAPYCSVACYKTHRDSPQCATRESDLKKTEVGYQEEPTLHVPF--PT 64
            :.|.||...:.||||..|..||||:.|:|.|:::| || :.||...||......|...||.  |.
plant     7 QTCEICEKVVSKYKCPSCLVPYCSLGCFKIHKETP-CA-KPSDPSSTEEKPAASPAKEVPVKRPE 69

  Fly    65 DDTVAAEKLQQ-------------------------LENCQ--------ELRNLLHNPHLRSLLQ 96
            :.....||.||                         ||..|        |:|..|.:..|:.|:.
plant    70 EANDVVEKTQQKASAASPAKEIPVARPIIVEEEKYILEKTQFEAIASSSEIREALKDEPLQKLIY 134

  Fly    97 QIDVAINAQSAMMAAMQEPLFVEFANACLQVVEPMTDAE 135
            .||.:.|....:..||....|.||.:..|..:....|.:
plant   135 SIDSSSNPLQELDEAMGIEAFREFTDKILSNISKSNDEQ 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8204NP_001286464.1 zf-HIT 1..30 CDD:282314 13/27 (48%)
AT4G28820NP_001329310.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2857
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 60 1.000 Inparanoid score I2549
OMA 1 1.010 - - QHG57310
OrthoDB 1 1.010 - - D1551354at2759
OrthoFinder 1 1.000 - - FOG0005675
OrthoInspector 1 1.000 - - oto3965
orthoMCL 1 0.900 - - OOG6_104054
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X4652
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.740

Return to query results.
Submit another query.