DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8204 and znhit3

Sequence 1:NP_001286464.1 Gene:CG8204 FlyBaseID:FBgn0034033 Length:143 Species:Drosophila melanogaster
Sequence 2:NP_001039046.1 Gene:znhit3 XenbaseID:XB-GENE-5750415 Length:145 Species:Xenopus tropicalis

Alignment Length:136 Identity:49/137 (36%)
Similarity:73/137 (53%) Gaps:8/137 (6%)


  Fly     1 MEKCIICVDNLRKYKCSKCSAPYCSVACYKTHRDSPQCATRE------SDLKKTEVGYQEEPTLH 59
            ::.|.:|.....||:|..|.|.||||:|.|.|::  :|..:.      :.:.:.|.....|..|.
 Frog     3 LKPCCVCYSVTPKYRCPGCRARYCSVSCCKRHKE--ECTLKSTPADTITQIDRGEKLLPREDDLI 65

  Fly    60 VPFPTDDTVAAEKLQQLENCQELRNLLHNPHLRSLLQQIDVAINAQSAMMAAMQEPLFVEFANAC 124
            ......|.|...||:.|...::|::||.|||||.||.::|.|...:..:...||||||||||:.|
 Frog    66 DEDNESDRVPQHKLKLLGESEKLKHLLLNPHLRELLIKLDQAEEREDTVKKYMQEPLFVEFADRC 130

  Fly   125 LQVVEP 130
            |.::||
 Frog   131 LSIIEP 136

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8204NP_001286464.1 zf-HIT 1..30 CDD:282314 12/29 (41%)
znhit3NP_001039046.1 zf-HIT 2..32 CDD:309543 12/29 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C196870784
eggNOG 1 0.900 E1_KOG2857
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H37964
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1551354at2759
OrthoFinder 1 1.000 FOG0006188
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R130
TreeFam 1 0.960
98.750

Return to query results.
Submit another query.