powered by:
Protein Alignment CG8204 and ZNHIT6
DIOPT Version :9
| Sequence 1: | NP_001286464.1 |
Gene: | CG8204 / 36728 |
FlyBaseID: | FBgn0034033 |
Length: | 143 |
Species: | Drosophila melanogaster |
| Sequence 2: | NP_060423.3 |
Gene: | ZNHIT6 / 54680 |
HGNCID: | 26089 |
Length: | 470 |
Species: | Homo sapiens |
| Alignment Length: | 38 |
Identity: | 13/38 - (34%) |
| Similarity: | 18/38 - (47%) |
Gaps: | 0/38 - (0%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 1 MEKCIICVDNLRKYKCSKCSAPYCSVACYKTHRDSPQC 38
|.:|..|.....||:|.:|....||:.|.|.|:....|
Human 217 MSRCETCGTEEAKYRCPRCMRYSCSLPCVKKHKAELTC 254
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
| Tool |
Simple Score |
Weighted Score |
Original Tool Information |
| BLAST Result |
Score |
Score Type |
Cluster ID |
| Compara |
0 | 0.000 |
Not matched by this tool. |
| Domainoid |
0 | 0.000 |
Not matched by this tool. |
| eggNOG |
0 | 0.000 |
Not matched by this tool. |
| Hieranoid |
0 | 0.000 |
Not matched by this tool. |
| Homologene |
0 | 0.000 |
Not matched by this tool. |
| Inparanoid |
0 | 0.000 |
Not matched by this tool. |
| Isobase |
0 | 0.000 |
Not matched by this tool. |
| OMA |
0 | 0.000 |
Not matched by this tool. |
| OrthoDB |
0 | 0.000 |
Not matched by this tool. |
| OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
| OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
| orthoMCL |
0 | 0.000 |
Not matched by this tool. |
| Panther |
0 | 0.000 |
Not matched by this tool. |
| Phylome |
0 | 0.000 |
Not matched by this tool. |
| RoundUp |
1 |
1.030 |
- |
avgDist |
Average_Evolutionary_Distance |
R130 |
| SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
| SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
| TreeFam |
0 | 0.000 |
Not matched by this tool. |
| User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.030 |
|
Return to query results.
Submit another query.