DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8204 and Znhit3

Sequence 1:NP_001286464.1 Gene:CG8204 FlyBaseID:FBgn0034033 Length:143 Species:Drosophila melanogaster
Sequence 2:XP_001081104.2 Gene:Znhit3 RGDID:1598226 Length:151 Species:Rattus norvegicus

Alignment Length:146 Identity:57/147 (39%)
Similarity:79/147 (54%) Gaps:30/147 (20%)


  Fly     4 CIICVDNLRKYKCSKCSAPYCSVACYKTHRDSPQCATRESDLKKTEVGYQEEPTLHVPFPT---- 64
            |:||.:. .||:|..|..|||||||::.|::  ||.:....::|:       ||: ||..|    
  Rat    11 CVICSEK-PKYRCPACRVPYCSVACFQKHKE--QCNSEARPVEKS-------PTV-VPVRTEENK 64

  Fly    65 ---------------DDTVAAEKLQQLENCQELRNLLHNPHLRSLLQQIDVAINAQSAMMAAMQE 114
                           ||.|:.:.|:.|...:.||:||.|||||.|:..:|...|....|.|.|||
  Rat    65 GDDSSIADFLNSDEEDDRVSVQSLKNLGKSETLRSLLLNPHLRQLMISLDQGDNKAKLMKACMQE 129

  Fly   115 PLFVEFANACLQVVEP 130
            |||||||:.||::|||
  Rat   130 PLFVEFADCCLRIVEP 145

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8204NP_001286464.1 zf-HIT 1..30 CDD:282314 14/26 (54%)
Znhit3XP_001081104.2 zf-HIT 8..36 CDD:282314 14/26 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C196871229
eggNOG 1 0.900 E1_KOG2857
Hieranoid 1 1.000
Homologene 1 1.000 H37964
Inparanoid 1 1.050 98 1.000 Inparanoid score I4857
OMA 1 1.010
OrthoDB 1 1.010 D1551354at2759
OrthoFinder 1 1.000 FOG0006188
OrthoInspector 1 1.000 T1085902
orthoMCL 1 0.900 OOG5_130154
Panther 1 1.100 LDO PTHR13483
Phylome 1 0.910 0.667 Consistency score
TreeFam 1 0.960
1312.770

Return to query results.
Submit another query.