DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8204 and Znhit3

Sequence 1:NP_001286464.1 Gene:CG8204 FlyBaseID:FBgn0034033 Length:143 Species:Drosophila melanogaster
Sequence 2:NP_001005223.1 Gene:Znhit3 MGIID:3051596 Length:151 Species:Mus musculus

Alignment Length:141 Identity:55/142 (39%)
Similarity:76/142 (54%) Gaps:20/142 (14%)


  Fly     4 CIICVDNLRKYKCSKCSAPYCSVACYKTHRDSPQCATRESDLKKTEVGYQEEPTLHVPFPTDDTV 68
            |::|::. .||:|..|..|||||.|::.|::  ||::....::|...|   .|........||:.
Mouse    11 CVVCLEK-PKYRCPTCRVPYCSVPCFQKHKE--QCSSEARPVEKRRAG---PPVRSEESKDDDSS 69

  Fly    69 AAE-----------KLQQLENCQE---LRNLLHNPHLRSLLQQIDVAINAQSAMMAAMQEPLFVE 119
            .|:           .||.|:|..|   ||:||.|||||.|:..:|...|....|.|.||||||||
Mouse    70 VADFLNSDEEEDRVSLQNLKNLGESETLRSLLLNPHLRQLMISLDQGDNKAKLMRACMQEPLFVE 134

  Fly   120 FANACLQVVEP 130
            ||:.||.:|||
Mouse   135 FADCCLGIVEP 145

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8204NP_001286464.1 zf-HIT 1..30 CDD:282314 12/26 (46%)
Znhit3NP_001005223.1 zf-HIT 7..36 CDD:282314 12/26 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C196872771
eggNOG 1 0.900 E1_KOG2857
Hieranoid 1 1.000
Homologene 1 1.000 H37964
Inparanoid 1 1.050 97 1.000 Inparanoid score I4984
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0006188
OrthoInspector 1 1.000 T1082301
orthoMCL 1 0.900 OOG5_130154
Panther 1 1.100 LDO PTHR13483
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R130
TreeFam 1 0.960
1312.790

Return to query results.
Submit another query.