DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8204 and znhit3

Sequence 1:NP_001286464.1 Gene:CG8204 FlyBaseID:FBgn0034033 Length:143 Species:Drosophila melanogaster
Sequence 2:NP_956567.1 Gene:znhit3 ZFINID:ZDB-GENE-040426-1114 Length:151 Species:Danio rerio

Alignment Length:151 Identity:63/152 (41%)
Similarity:87/152 (57%) Gaps:9/152 (6%)


  Fly     1 MEKCIICVDNLRKYKCSKCSAPYCSVACYKTHRDSPQC-ATRESD---LKKTEVGYQEEP-TLHV 60
            |:.|.:|.:.:.||:|..|...||||:|:|.|::...| ..:|||   .|...|...||| |:..
Zfish     1 MQLCGVCSELVPKYRCPACRIRYCSVSCFKRHKEDDSCDPVKESDPASSKPAAVSNAEEPWTVED 65

  Fly    61 PFPTD---DTVAAEKLQQLENCQELRNLLHNPHLRSLLQQIDVAINAQSAMMAAMQEPLFVEFAN 122
            ....|   |.|..::||||.:.:.|:.||.|||||.|:..:|.|.|...||..|||||||||||:
Zfish    66 LLDEDSQTDKVPLQRLQQLGDSEALKGLLRNPHLRQLMMSVDSAENKAKAMKDAMQEPLFVEFAD 130

  Fly   123 ACLQVVEPM-TDAERTEFELY 142
            .||:::||. ||....:.:.|
Zfish   131 QCLKIIEPSETDNNEDDDDEY 151

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8204NP_001286464.1 zf-HIT 1..30 CDD:282314 12/29 (41%)
znhit3NP_956567.1 zf-HIT 1..30 CDD:282314 12/29 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C196871553
eggNOG 1 0.900 E1_KOG2857
Hieranoid 1 1.000
Homologene 1 1.000 H37964
Inparanoid 1 1.050 111 1.000 Inparanoid score I4786
OMA 1 1.010
OrthoDB 1 1.010 D1551354at2759
OrthoFinder 1 1.000 FOG0006188
OrthoInspector 1 1.000 T1051696
orthoMCL 1 0.900 OOG5_130154
Panther 1 1.100 LDO PTHR13483
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R130
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1413.800

Return to query results.
Submit another query.