DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8204 and CG1463

Sequence 1:NP_001286464.1 Gene:CG8204 FlyBaseID:FBgn0034033 Length:143 Species:Drosophila melanogaster
Sequence 2:NP_001259489.1 Gene:CG1463 FlyBaseID:FBgn0030406 Length:336 Species:Drosophila melanogaster

Alignment Length:140 Identity:31/141 (22%)
Similarity:48/141 (34%) Gaps:23/141 (16%)


  Fly     4 CIICVDNLRKYKCSKCSAPYCSVACYKTHRDSPQCATRESDLKKTEVGYQEEPTLHVPFPTDDTV 68
            |.:|......|.|.||....||:.|.:.|:....|            ..|.:.|..||.  .:..
  Fly    17 CEVCAAKEACYACPKCEVKTCSLPCVQIHKKELNC------------DGQRDRTKFVPL--SEMT 67

  Fly    69 AAEKLQQ---LENC-QELRNLLHNPHLRSLLQQIDVAINAQSAMMAAMQEPLFVEFANACLQVVE 129
            :.|.:..   ||.| :...|...:|..|....|.::.:......|||.:..:     |..||:..
  Fly    68 SREFMSDYCFLEECTRYAENRKSDPCKRFTHDQRNLPVTQHRMRMAAKKRNI-----NLRLQLEN 127

  Fly   130 PMTDAERTEF 139
            .....|.|.:
  Fly   128 FSRHKENTTY 137

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8204NP_001286464.1 zf-HIT 1..30 CDD:282314 9/26 (35%)
CG1463NP_001259489.1 zf-HIT 17..43 CDD:282314 9/26 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR13483
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R130
22.130

Return to query results.
Submit another query.