DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8204 and SPAC4F10.19c

DIOPT Version :9

Sequence 1:NP_001286464.1 Gene:CG8204 / 36728 FlyBaseID:FBgn0034033 Length:143 Species:Drosophila melanogaster
Sequence 2:NP_594762.1 Gene:SPAC4F10.19c / 2543613 PomBaseID:SPAC4F10.19c Length:154 Species:Schizosaccharomyces pombe


Alignment Length:126 Identity:37/126 - (29%)
Similarity:63/126 - (50%) Gaps:29/126 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEKCIICVDNLRKYKCSKCSAPYCSVACYKTHRDSPQCATRESDLKKTEVGYQE-----EPTLHV 60
            |..|.||.::..||||.|||.||||:.|:|.|:.  ||.|...:...|..|.:|     ||:.:|
pombe     1 MTTCSICNESEIKYKCPKCSFPYCSLPCWKIHQS--QCETVNDNNTTTFKGVKEPLNPPEPSPNV 63

  Fly    61 -------PFPTDDTVAAEKLQQLENCQELRNLLHNPHLRSLLQQIDVAINAQSAMMAAMQE 114
                   |...::.:.:|.|        |.:::.:|.:::|::.     ||:  ::..|:|
pombe    64 IYVNGRIPSLAEEALPSESL--------LESIVEDPSIKNLIES-----NAE--LLHIMKE 109

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8204NP_001286464.1 zf-HIT 1..30 CDD:282314 16/28 (57%)
SPAC4F10.19cNP_594762.1 zf-HIT 1..30 CDD:282314 16/28 (57%)
fungal_TF_MHR <60..>132 CDD:304923 11/65 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2857
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 53 1.000 Inparanoid score I2044
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005675
OrthoInspector 1 1.000 - - oto101742
orthoMCL 1 0.900 - - OOG6_104054
Panther 1 1.100 - - LDO PTHR13483
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R130
SonicParanoid 1 1.000 - - X4652
TreeFam 1 0.960 - -
1110.850

Return to query results.
Submit another query.