DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8204 and SPAC4F10.19c

Sequence 1:NP_001286464.1 Gene:CG8204 FlyBaseID:FBgn0034033 Length:143 Species:Drosophila melanogaster
Sequence 2:NP_594762.1 Gene:SPAC4F10.19c PomBaseID:SPAC4F10.19c Length:154 Species:Schizosaccharomyces pombe

Alignment Length:126 Identity:37/127 (29%)
Similarity:63/127 (50%) Gaps:29/127 (23%)


  Fly     1 MEKCIICVDNLRKYKCSKCSAPYCSVACYKTHRDSPQCATRESDLKKTEVGYQE-----EPTLHV 60
            |..|.||.::..||||.|||.||||:.|:|.|:.  ||.|...:...|..|.:|     ||:.:|
pombe     1 MTTCSICNESEIKYKCPKCSFPYCSLPCWKIHQS--QCETVNDNNTTTFKGVKEPLNPPEPSPNV 63

  Fly    61 -------PFPTDDTVAAEKLQQLENCQELRNLLHNPHLRSLLQQIDVAINAQSAMMAAMQE 114
                   |...::.:.:|.|        |.:::.:|.:::|::.     ||:  ::..|:|
pombe    64 IYVNGRIPSLAEEALPSESL--------LESIVEDPSIKNLIES-----NAE--LLHIMKE 109

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8204NP_001286464.1 zf-HIT 1..30 CDD:282314 16/29 (55%)
SPAC4F10.19cNP_594762.1 zf-HIT 1..30 CDD:282314 16/29 (55%)
fungal_TF_MHR <60..>132 CDD:304923 11/66 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 53 1.000 Inparanoid score I2013
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0006188
OrthoInspector 1 1.000 T1124260
orthoMCL 1 0.900 OOG5_130154
Panther 1 1.100 LDO PTHR13483
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R130
TreeFam 1 0.960
98.950

Return to query results.
Submit another query.