DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8204 and SPCC613.07

Sequence 1:NP_001286464.1 Gene:CG8204 FlyBaseID:FBgn0034033 Length:143 Species:Drosophila melanogaster
Sequence 2:NP_587695.1 Gene:SPCC613.07 PomBaseID:SPCC613.07 Length:345 Species:Schizosaccharomyces pombe

Alignment Length:58 Identity:14/59 (24%)
Similarity:24/59 (41%) Gaps:12/59 (20%)


  Fly     4 CIICVDNLRKYKCSKCSAPYCSVACYKTHRDSPQCATRESDLKKTEVGYQEEPTLHVP 61
            |..|..|..||:|.:|.:.:|.:.|...|:...:|:.            :.:|...||
pombe     9 CSTCQKNASKYRCPRCDSRFCCLECNLEHKRLTKCSG------------ERDPATFVP 54

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8204NP_001286464.1 zf-HIT 1..30 CDD:282314 9/26 (35%)
SPCC613.07NP_587695.1 zf-HIT 8..33 CDD:282314 8/24 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R130
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.