powered by:
Protein Alignment CG8204 and znhit6
DIOPT Version :9
| Sequence 1: | NP_001286464.1 |
Gene: | CG8204 / 36728 |
FlyBaseID: | FBgn0034033 |
Length: | 143 |
Species: | Drosophila melanogaster |
| Sequence 2: | XP_017209143.1 |
Gene: | znhit6 / 100332549 |
ZFINID: | ZDB-GENE-110411-38 |
Length: | 370 |
Species: | Danio rerio |
| Alignment Length: | 39 |
Identity: | 13/39 - (33%) |
| Similarity: | 19/39 - (48%) |
Gaps: | 0/39 - (0%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 1 MEKCIICVDNLRKYKCSKCSAPYCSVACYKTHRDSPQCA 39
|.:|.:|.....||:|..|....||:.|.|.|:....|:
Zfish 27 MSRCDVCDCEEAKYRCPSCKKHTCSLVCVKRHKSVSGCS 65
|
Known Domains:
Indicated by green bases in alignment.
| Gene | Sequence | Domain | Region |
External ID | Identity |
| CG8204 | NP_001286464.1 |
zf-HIT |
1..30 |
CDD:282314 |
10/28 (36%) |
| znhit6 | XP_017209143.1 |
None |
Information from Original Tools:
| Tool |
Simple Score |
Weighted Score |
Original Tool Information |
| BLAST Result |
Score |
Score Type |
Cluster ID |
| Compara |
0 | 0.000 |
Not matched by this tool. |
| Domainoid |
0 | 0.000 |
Not matched by this tool. |
| eggNOG |
0 | 0.000 |
Not matched by this tool. |
| Hieranoid |
0 | 0.000 |
Not matched by this tool. |
| Homologene |
0 | 0.000 |
Not matched by this tool. |
| Inparanoid |
0 | 0.000 |
Not matched by this tool. |
| OMA |
0 | 0.000 |
Not matched by this tool. |
| OrthoDB |
0 | 0.000 |
Not matched by this tool. |
| OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
| OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
| orthoMCL |
0 | 0.000 |
Not matched by this tool. |
| Panther |
0 | 0.000 |
Not matched by this tool. |
| Phylome |
0 | 0.000 |
Not matched by this tool. |
| RoundUp |
1 |
1.030 |
- |
avgDist |
Average_Evolutionary_Distance |
R130 |
| SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
| SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
| TreeFam |
0 | 0.000 |
Not matched by this tool. |
| ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.030 |
|
Return to query results.
Submit another query.