DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8192 and CG13643

Sequence 1:NP_611047.2 Gene:CG8192 FlyBaseID:FBgn0034030 Length:431 Species:Drosophila melanogaster
Sequence 2:NP_001262937.1 Gene:CG13643 FlyBaseID:FBgn0040601 Length:819 Species:Drosophila melanogaster

Alignment Length:499 Identity:97/500 (19%)
Similarity:157/500 (31%) Gaps:192/500 (38%)


  Fly    27 TGSPSATATTAKPKGFEARSLDVNSSGGEEELDDFETQAQ-THLAYRQQ---PQQ-----QRQLY 82
            |.||.|::|....||                :.|||.::: |..|.|:|   ||:     |.:..
  Fly   411 TTSPPASSTKVTGKG----------------VQDFEKRSKPTSAAVRKQKLGPQESNFINQNEFV 459

  Fly    83 EYSEEDQEEAPRPVYANRNAKQQSNYL------------KIQGQLKKPLSEESEEE--------- 126
            :.|:..:.:.|:|...   |:.:.|.|            ::.||...|.|..|.:.         
  Fly   460 DLSKSTKLQQPQPFQV---AQTKPNQLEPHYQRHKPQVTRVGGQEPAPFSAPSSKPRSFTSRGSI 521

  Fly   127 ----------EEEVEEPDRLSTLLSKSSFS-CTDRNSGY---YADESLSCEVFHYCQESQK---H 174
                      ::|:..|...||..:|.::: .|.|.:.|   |.....|.:.....|.:.|   |
  Fly   522 TYKATTERYVDQELYYPTTSSTTRAKEAYTPTTFRPTTYKKPYEQSYQSQQTHRPTQAATKKAAH 586

  Fly   175 SWICPEGFTFHQIHLICMPPS----HDNICKQSSKYHIVNDYLYKPINLQEHQSKPNVTLRYSER 235
            |             :...||:    |.|:.:...:||   ..||                   |.
  Fly   587 S-------------VTSAPPTTTNPHANVDEDDGQYH---PELY-------------------EN 616

  Fly   236 YFPEN--YYEHERYDDEEEQLPAAP-----RPR-IQQQHHQQQHQQPQQQHRQVLAYQQPQQQPQ 292
            .||.|  .:...|.........:||     :|. .||.||   |.:.|||.    .||:.:::.:
  Fly   617 DFPRNRIRFLRNRSTSSTTSTTSAPVVSSRQPHGFQQAHH---HLKSQQQS----VYQKERERER 674

  Fly   293 VRVQ-------------------------------YQQPQQHQHHQQQAQPQAQVVTQIRHQPQP 326
            .|.:                               |:..:..|.:..|..||.....|.......
  Fly   675 ERERESDLSDEDELFKTAQSLNFGAASINKLRADIYKAEKTSQQYNSQYSPQLASSPQASSSSSS 739

  Fly   327 QPTTLAYRKPQPVTTVQPQLQLHQLHQPQLQLHQQRPQTLAPTVTPAPYRFFTAAPQLQ-----H 386
            ..:|.:.......||.                  :||.|...|.|..   |.|:||.::     .
  Fly   740 STSTTSTTTSTTTTTT------------------RRPPTTVRTTTTT---FTTSAPPVETKKSVK 783

  Fly   387 LQQQQQQVFRTPEEINISLQQRRPQVFIATTPRYYED---EYLY 427
            .:::|||:.:......     :||       |...||   :|.|
  Fly   784 SKKEQQQLEKKDRPAG-----KRP-------PHADEDTSYDYAY 815

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8192NP_611047.2 CBM_14 147..200 CDD:279884 13/63 (21%)
CG13643NP_001262937.1 CBM_14 63..126 CDD:279884
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR22933
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.