DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8192 and CG14880

Sequence 1:NP_611047.2 Gene:CG8192 FlyBaseID:FBgn0034030 Length:431 Species:Drosophila melanogaster
Sequence 2:NP_650538.1 Gene:CG14880 FlyBaseID:FBgn0038422 Length:637 Species:Drosophila melanogaster

Alignment Length:348 Identity:74/349 (21%)
Similarity:125/349 (36%) Gaps:91/349 (26%)


  Fly   123 SEEEEEEVEEPDRLSTLLSKSSFSCTDRNSGYYADESLSCEVFHYCQE-SQKHSWICPEGFTFHQ 186
            :.|.:..:.:.:..|.|:.|:||||..|.:|||||....|:|:|.|.. .::.|:.||....|.|
  Fly    27 ASEAQNAIPKTNPASLLIQKTSFSCAGRPAGYYADVETGCQVYHMCDGLGRQFSYTCPNTTLFQQ 91

  Fly   187 IHLICMPPSHDNICKQSSKYHIVNDYLYKPINLQEHQSKPNVTLRYSERYFPENYYEHERYDDEE 251
            ..|||                   |:.|. :|..:.:|.....|...:|..|        :.::|
  Fly    92 RMLIC-------------------DHWYM-VNCSKAESNYAANLLIGQRDKP--------FVNDE 128

  Fly   252 EQLPAAPRPRI--------------QQQHHQQQHQQPQQQHRQVLAYQQPQQQPQV-RVQYQ--- 298
            |.....|||.:              :.|:.|....|.|.:...|......:..||: :.:::   
  Fly   129 ENSLRTPRPDLLDRPYAPDYSGESFRSQYKQFTSNQNQIRDESVKGAGAGKSDPQISQTRWRIPP 193

  Fly   299 ----------QPQQHQHHQQQAQPQAQVVTQ----IRHQPQPQPTTLAYRKPQPVTTVQPQLQLH 349
                      :||......|.|:|:..::|.    .|.....:|||.........||.:|.:.. 
  Fly   194 PSRTILPPAYEPQIELPSAQSAKPRIPIITSTTTTTRATTTTRPTTTTRATTTTTTTRRPPVTA- 257

  Fly   350 QLHQPQLQLHQQRPQ----------TLAPTVTPAPYRFFTAAPQLQHLQQQQQQVFRTPEEINIS 404
               :|:..||.:||.          |...|.......|.:|...|:..:|...::.:        
  Fly   258 ---RPKEALHNRRPNFQEHDMDDLGTSHSTRYNTSADFNSAESPLRETKQSSTKLTK-------- 311

  Fly   405 LQQRRPQVFIATTPRYYEDEYLY 427
                    ||....:.||..::|
  Fly   312 --------FIKPPSKIYEPPFVY 326

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8192NP_611047.2 CBM_14 147..200 CDD:279884 19/54 (35%)
CG14880NP_650538.1 CBM_14 51..104 CDD:279884 22/73 (30%)
COG3979 336..>457 CDD:226487
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR22933
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.